• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens matrin 3 (MATR3), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu17749 Homo sapiens matrin 3 (MATR3), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu17749C Homo sapiens matrin 3 (MATR3), transcript variant 1, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_199189.2, 303227922
Length 2544 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens matrin 3 (MATR3), transcript variant 1, mRNA.
Product matrin-3 isoform a
Comment

Summary: This gene encodes a nuclear matrix protein, which is proposed to stabilize certain messenger RNA species. Mutations of this gene are associated with distal myopathy 2, which often includes vocal cord and pharyngeal weakness. Alternatively spliced transcript variants, including read-through transcripts composed of the upstream small nucleolar RNA host gene 4 (non-protein coding) and matrin 3 gene sequence, have been identified. Pseudogenes of this gene are located on chromosomes 1 and X. [provided by RefSeq, Aug 2013].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (a). Variants 1-4 encode the same isoform (a).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_954659.1
CDS 779..3322
Misc Feature(1)758..760
Misc Feature(2)782..784
Misc Feature(3)782..784
Misc Feature(4)785..787
Misc Feature(5)788..790
Misc Feature(6)803..805
Misc Feature(7)818..820
Misc Feature(8)842..844
Misc Feature(9)899..901
Misc Feature(10)1130..1132
Misc Feature(11)1289..1291
Misc Feature(12)1340..1342
Misc Feature(13)1340..1342
Misc Feature(14)1361..1363
Misc Feature(15)1361..1363
Misc Feature(16)1382..1384
Misc Feature(17)1394..1396
Misc Feature(18)1394..1396
Misc Feature(19)1400..1402
Misc Feature(20)1400..1402
Misc Feature(21)1433..1435
Misc Feature(22)1493..1495
Misc Feature(23)1496..1498
Misc Feature(24)1505..1507
Misc Feature(25)1640..1744
Misc Feature(26)1967..1969
Misc Feature(27)1970..2197
Misc Feature(28)2264..2503
Misc Feature(29)2342..2344
Misc Feature(30)2375..2377
Misc Feature(31)2489..2491
Misc Feature(32)<2528..2812
Misc Feature(33)2564..2566
Misc Feature(34)2564..2566
Misc Feature(35)2567..2569
Misc Feature(36)2570..2572
Misc Feature(37)2570..2572
Misc Feature(38)2588..2590
Misc Feature(39)2588..2590
Misc Feature(40)2588..2590
Misc Feature(41)2594..2596
Misc Feature(42)2594..2596
Misc Feature(43)2693..2695
Misc Feature(44)2708..2710
Misc Feature(45)2738..2740
Misc Feature(46)2789..2791
Misc Feature(47)2795..2797
Misc Feature(48)2798..2800
Misc Feature(49)2813..2815
Misc Feature(50)2843..2845
Misc Feature(51)2906..2932
Misc Feature(52)2999..3001
Misc Feature(53)3017..3019
Misc Feature(54)3074..3076
Misc Feature(55)3170..3277
Misc Feature(56)3284..3286
Exon (1)1..410
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (2)411..440
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (3)441..522
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (4)523..601
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (5)602..1690
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (6)1691..1752
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (7)1753..1794
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (8)1795..1907
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (9)1908..1960
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (10)1961..2086
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (11)2087..2212
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (12)2213..2380
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (13)2381..2512
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (14)2513..2556
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (15)2557..2926
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (16)2927..3149
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (17)3150..3271
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Exon (18)3272..5604
Gene:MATR3
Gene Synonym:ALS21; MPD2; VCPDM
Translation MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTARLASLMNLGM SSSLNQQGAHSALSSASTSSHNLQSIFNIGSRGPLPLSSQHRGDADQASNILASFGLSAR DLDELSRYPEDKITPENLPQILLQLKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWEE KRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYYDRMDYEDDRLRDGERCRDDSFFGETS HNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIEDFHGLLPKGYPHLCSICDLPV HSNKEWSQHINGASHSRRCQLLLEIYPEWNPDNDTGHTMGDPFMLQQSTNPAPGILGPPP PSFHLGGPAVGPRGNLGAGNGNLQGPRHMQKGRVETSRVVHIMDFQRGKNLRYQLLQLVE PFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKKP EGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEME TREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLVLRIPNRGIDLLKKDKSRKRSYSPD GKESPSDKKSKTDGSQKTESSTEGKEQEEKSGEDGEKDTKDDQTEQEPNMLLESEDELLV DEEEAAALLESGSSVGDETDLANLGDVASDGKKEPSDKAVKKDGSASAAAKKKLKKVDKI EELDQENEAALENGIKNEENTEPGAESSENADDPNKDTSENADGQSDENKDDYTIPDEYR IGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAEE RRQKKET
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
39+dbSNP:
39+a, gdbSNP:111431805
169+c, gdbSNP:11242456
210+a, gdbSNP:370073406
226+c, tdbSNP:375526985
229+c, tdbSNP:375367241
239+a, tdbSNP:75834145
532+dbSNP:
532+c, tdbSNP:141402332
589+c, tdbSNP:182932144
602+dbSNP:
602+a, tdbSNP:372811988
671..672+, tdbSNP:112107315
675..676+, adbSNP:76925455
676..677+, g, tdbSNP:59150359
677+g, tdbSNP:374791274
687+c, tdbSNP:56079023
723+a, gdbSNP:59033177
728..729+, adbSNP:200290629
735..736+a, tdbSNP:11557008
736+a, tdbSNP:12153162
736+, tdbSNP:372628597
737+a, tdbSNP:192397681
746+a, tdbSNP:78286200
748+a, tdbSNP:76290767
774+c, gdbSNP:375381025
793+c, tdbSNP:184609870
1032+c, gdbSNP:121434591
1033+c, tdbSNP:56024855
1034+a, gdbSNP:201277902
1045+c, tdbSNP:199535878
1069+a, gdbSNP:147239107
1242+a, cdbSNP:145034978
1270+c, tdbSNP:202136777
1277+c, tdbSNP:138894013
1309+c, tdbSNP:367924183
1330+g, tdbSNP:370460445
1339+g, tdbSNP:374819399
1357+c, tdbSNP:201669857
1370+c, gdbSNP:148980401
1397+c, tdbSNP:190049582
1432+c, tdbSNP:200346989
1453+a, gdbSNP:199711502
1459+a, gdbSNP:201046923
1467+c, g, tdbSNP:200871699
1478+c, tdbSNP:56286276
1484+g, tdbSNP:192888077
1545+a, gdbSNP:372859031
1601+a, gdbSNP:375756727
1894+dbSNP:
1894+a, gdbSNP:375938101
1897+a, gdbSNP:112328704
1910+dbSNP:
1910+a, gdbSNP:201075828
1943+a, gdbSNP:143840998
2023+dbSNP:
2023+a, gdbSNP:376424446
2051+a, gdbSNP:370556662
2105+dbSNP:
2105+a, gdbSNP:200301291
2125+c, tdbSNP:141986556
2146+c, tdbSNP:200027384
2148+c, tdbSNP:199624996
2155+a, gdbSNP:147356202
2163+g, tdbSNP:371045547
2240+dbSNP:
2240+c, tdbSNP:201613971
2261+a, gdbSNP:200584655
2265+a, gdbSNP:368389424
2419+dbSNP:
2419+a, cdbSNP:202035773
2467+c, tdbSNP:201037038
2526+dbSNP:
2526+g, tdbSNP:372800555
2639+dbSNP:
2639+g, tdbSNP:376261978
2671+c, tdbSNP:143527811
2674+c, tdbSNP:202208841
2692+c, tdbSNP:369312174
2695+a, gdbSNP:147164878
2769+a, cdbSNP:139589527
2794+c, gdbSNP:376884680
2892+g, tdbSNP:201970174
2938+dbSNP:
2938+c, tdbSNP:367739358
2951+c, tdbSNP:1801868
2969+c, tdbSNP:149714542
2997+a, gdbSNP:201019485
3012+c, tdbSNP:199797401
3028+c, tdbSNP:373216736
3042+a, gdbSNP:144637575
3061+c, tdbSNP:189752689
3062+a, gdbSNP:148487997
3072+a, gdbSNP:200320584
3096+a, c, gdbSNP:368217486
3104+c, tdbSNP:370051410
3138+a, gdbSNP:148402819
3232+dbSNP:
3232+c, tdbSNP:146550337
3282+dbSNP:
3282+a, gdbSNP:201165929
3304+a, gdbSNP:374252881
3321+a, gdbSNP:200664940
3333+c, gdbSNP:374903488
3408..3411+, ttagdbSNP:368308621
3434+a, gdbSNP:55932698
3491..3492+, adbSNP:375682201
3499+a, gdbSNP:13698
3519+c, tdbSNP:183623114
3554+c, gdbSNP:377192161
3597+c, tdbSNP:187985845
3635+a, gdbSNP:180806333
3728+a, gdbSNP:185734839
3756+a, gdbSNP:190578145
3818+c, tdbSNP:140707719
3962+a, gdbSNP:145836548
3994+a, gdbSNP:7305
4007+a, cdbSNP:376391287
4014+a, gdbSNP:15250
4030+c, tdbSNP:14109
4069+c, gdbSNP:181792838
complement(4100)-g, adbSNP:1801867
4265+a, gdbSNP:77010866
4329+a, gdbSNP:141919082
4398+c, tdbSNP:2015602
4409+c, gdbSNP:116660718
4458+g, tdbSNP:7448794
4521+a, gdbSNP:371119946
4581+c, gdbSNP:62381613
4593+a, cdbSNP:150746889
4600+c, tdbSNP:116341961
4609+a, cdbSNP:186857653
4610+g, tdbSNP:10515507
4626+c, gdbSNP:4454047
4683+g, tdbSNP:1897581
4741..4742+, cdbSNP:35263875
4747+c, gdbSNP:145516036
4778+g, tdbSNP:370405215
4804+a, tdbSNP:79616595
4835..4840+, agtctcdbSNP:374910018
4857+a, gdbSNP:111689401
4891+g, tdbSNP:147136715
5079+c, tdbSNP:191196444
5089+c, tdbSNP:181125183
5113+a, gdbSNP:144515208
5130..5132+, atgdbSNP:144802057
5376+a, tdbSNP:116278472
5434+a, gdbSNP:368175267
5498+c, tdbSNP:185678902
Gene SymbolMATR3
Gene SynonymALS21; MPD2; VCPDM
Chromosome5
Locus Map5q31.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_199189 Homo sapiens matrin 3 (MATR3), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_199189 Homo sapiens matrin 3 (MATR3), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_199189 Homo sapiens matrin 3 (MATR3), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_199189 Homo sapiens matrin 3 (MATR3), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_199189 Homo sapiens matrin 3 (MATR3), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_199189 Homo sapiens matrin 3 (MATR3), transcript variant 1, mRNA. On-demand $279.00 12-14
Title HIV-1 pre-mRNA commitment to Rev mediated export through PSF and Matrin 3 .
Author Kula A, Gharu L and Marcello A.
Journal Virology 435 (2), 329-340 (2013)
Title Matrin 3 binds and stabilizes mRNA .
Author Salton M, Elkon R, Borodina T, Davydov A, Yaspo ML, Halperin E and Shiloh Y.
Journal PLoS ONE 6 (8), E23882 (2011)
Title Matrin 3 and HIV Rev regulation of mRNA .
Author Dayton AI.
Journal Retrovirology 8, 62 (2011)
Title Autosomal-dominant distal myopathy associated with a recurrent missense mutation in the gene encoding the nuclear matrix protein, matrin 3 .
Author Senderek J, Garvey SM, Krieger M, Guergueltcheva V, Urtizberea A, Roos A, Elbracht M, Stendel C, Tournev I, Mihailova V, Feit H, Tramonte J, Hedera P, Crooks K, Bergmann C, Rudnik-Schoneborn S, Zerres K, Lochmuller H, Seboun E, Weis J, Beckmann JS, Hauser MA and Jackson CE.
Journal Am. J. Hum. Genet. 84 (4), 511-518 (2009)
Title Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning .
Author Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD and Chen JL.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (17), 9543-9548 (2000)
Title Vocal cord and pharyngeal weakness with autosomal dominant distal myopathy: clinical description and gene localization to 5q31 .
Author Feit H, Silbergleit A, Schneider LB, Gutierrez JA, Fitoussi RP, Reyes C, Rouleau GA, Brais B, Jackson CE, Beckmann JS and Seboun E.
Journal Am. J. Hum. Genet. 63 (6), 1732-1742 (1998)
Title Mapping of human DNA-binding nuclear protein (NP220) to chromosome band 2p13.1-p13.2 and its relation to matrin 3 .
Author Okumara K, Nogami M, Matsushima Y, Matsumura K, Nakamura K, Taguchi
Journal Biosci. Biotechnol. Biochem. 62 (8), 1640-1642 (1998)
Title Human U19 intron-encoded snoRNA is processed from a long primary transcript that possesses little potential for protein coding .
Author Bortolin ML and Kiss T.
Journal RNA 4 (4), 445-454 (1998)
Title Molecular cloning of matrin 3. A 125-kilodalton protein of the nuclear matrix contains an extensive acidic domain .
Author Belgrader P, Dey R and Berezney R.
Journal J. Biol. Chem. 266 (15), 9893-9899 (1991)
Title The nuclear matrix from cells of different origin. Evidence for a common set of matrix proteins .
Author Stuurman N, Meijne AM, van der Pol AJ, de Jong L, van Driel R and van Renswoude J.
Journal J. Biol. Chem. 265 (10), 5460-5465 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.