• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens polymerase (RNA) I polypeptide C, 30kDa (POLR1C), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu17883 Homo sapiens polymerase (RNA) I polypeptide C, 30kDa (POLR1C), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu17883C Homo sapiens polymerase (RNA) I polypeptide C, 30kDa (POLR1C), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_203290.2, 327365362
Length 1041 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens polymerase (RNA) I polypeptide C, 30kDa (POLR1C), mRNA.
Product DNA-directed RNA polymerases I and III subunit RPAC1
Comment

Summary: The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Defects in this gene have been associated with Treacher Collins syndrome (TCS). [provided by RefSeq, Mar 2011].

RefSeq NP_976035.1
CDS 72..1112
Misc Feature(1)75..77
Misc Feature(2)75..77
Misc Feature(3)168..170
Misc Feature(4)216..1088
Misc Feature(5)order(216..224,237..242,264..266,276..278,282..287,
Misc Feature(6)252..1079
Misc Feature(7)order(291..293,300..305,315..317,375..377,381..386,
Misc Feature(8)order(336..356,378..380,393..395,732..737,741..743)
Misc Feature(9)order(369..371,396..398,405..407,570..572,576..578,
Exon (1)1..140
Gene:POLR1C
Gene Synonym:RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (2)141..212
Gene:POLR1C
Gene Synonym:RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (3)213..320
Gene:POLR1C
Gene Synonym:RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (4)321..453
Gene:POLR1C
Gene Synonym:RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (5)454..573
Gene:POLR1C
Gene Synonym:RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (6)574..726
Gene:POLR1C
Gene Synonym:RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (7)727..876
Gene:POLR1C
Gene Synonym:RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (8)877..993
Gene:POLR1C
Gene Synonym:RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (9)994..1325
Gene:POLR1C
Gene Synonym:RPA39; RPA40; RPA5; RPAC1; TCS3
Translation MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENS LEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPR LFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGN QADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDIT LLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLA RVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
12+dbSNP:
12+a, cdbSNP:113801285
14+c, tdbSNP:367568324
39+a, gdbSNP:375003894
49+c, tdbSNP:367690043
51+a, gdbSNP:190872536
complement(57)-t, cdbSNP:2231757
58+c, tdbSNP:377259758
64+a, gdbSNP:142683244
complement(68)-t, cdbSNP:2231756
79+c, tdbSNP:138184356
93+a, gdbSNP:201071477
105+a, gdbSNP:200115914
108+c, tdbSNP:201754745
136+a, gdbSNP:149529196
150+dbSNP:
150+a, gdbSNP:144054843
187+c, tdbSNP:148236144
201+a, cdbSNP:186395114
220+dbSNP:
220+a, gdbSNP:368486399
264+a, gdbSNP:141471029
292+a, gdbSNP:371802902
318+c, gdbSNP:11544826
complement(340)-dbSNP:
complement(340)-g, adbSNP:74604392
408+a, tdbSNP:55653636
429+c, tdbSNP:146332364
438+a, gdbSNP:374405229
461+dbSNP:
461+a, gdbSNP:374806421
466+a, gdbSNP:201320592
474+a, gdbSNP:371870708
492+c, tdbSNP:148385032
514+a, gdbSNP:144195949
523+a, gdbSNP:146162408
560+c, tdbSNP:187997427
561+a, gdbSNP:200525225
581+dbSNP:
581+c, gdbSNP:140188270
599+c, tdbSNP:367732777
621+c, gdbSNP:149840242
632+a, gdbSNP:145813943
643+a, gdbSNP:373046018
668+c, tdbSNP:112689763
669+a, gdbSNP:148979835
680+g, tdbSNP:150870449
705+a, gdbSNP:79222964
716+c, tdbSNP:377211362
740+dbSNP:
740+c, gdbSNP:374207903
759+a, cdbSNP:79826982
833+c, tdbSNP:147793518
858+a, gdbSNP:200121299
906+dbSNP:
906+c, tdbSNP:141156009
907+a, gdbSNP:191582628
916+c, gdbSNP:371479150
934+c, tdbSNP:146936712
944+g, tdbSNP:372836799
946+a, gdbSNP:374854435
953+g, tdbSNP:386352351
988+a, gdbSNP:137871425
1009+dbSNP:
1009+c, tdbSNP:181576159
1019+a, gdbSNP:371041894
1050+a, tdbSNP:387907020
1071+c, tdbSNP:376732667
1096+c, tdbSNP:140888409
1115+c, tdbSNP:112057763
1117+a, gdbSNP:370935238
1142+c, tdbSNP:185499373
complement(1204)-t, gdbSNP:140085360
1215+c, tdbSNP:1127166
1285+a, gdbSNP:372299856
Gene SymbolPOLR1C
Gene SynonymRPA39; RPA40; RPA5; RPAC1; TCS3
Chromosome6
Locus Map6p21.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_203290 Homo sapiens polymerase (RNA) I polypeptide C, 30kDa (POLR1C), mRNA. In-stock $99.00 5-7
NM_203290 Homo sapiens polymerase (RNA) I polypeptide C, 30kDa (POLR1C), mRNA. In-stock $99.00 5-7
Title Mutations in genes encoding subunits of RNA polymerases I and III cause Treacher Collins syndrome .
Author Dauwerse JG, Dixon J, Seland S, Ruivenkamp CA, van Haeringen A, Hoefsloot LH, Peters DJ, Boers AC, Daumer-Haas C, Maiwald R, Zweier C, Kerr B, Cobo AM, Toral JF, Hoogeboom AJ, Lohmann DR, Hehr U, Dixon MJ, Breuning MH and Wieczorek D.
Journal Nat. Genet. 43 (1), 20-22 (2011)
Title hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes .
Author Lamesch P, Li N, Milstein S, Fan C, Hao T, Szabo G, Hu Z, Venkatesan K, Bethel G, Martin P, Rogers J, Lawlor S, McLaren S, Dricot A, Borick H, Cusick ME, Vandenhaute J, Dunham I, Hill DE and Vidal M.
Journal Genomics 89 (3), 307-315 (2007)
Title Transcriptome analysis of human gastric cancer .
Author Oh JH, Yang JO, Hahn Y, Kim MR, Byun SS, Jeon YJ, Kim JM, Song KS, Noh SM, Kim S, Yoo HS, Kim YS and Kim NS.
Journal Mamm. Genome 16 (12), 942-954 (2005)
Title Nucleolar proteome dynamics .
Author Andersen JS, Lam YW, Leung AK, Ong SE, Lyon CE, Lamond AI and Mann M.
Journal Nature 433 (7021), 77-83 (2005)
Title Immunoaffinity profiling of tyrosine phosphorylation in cancer cells .
Author Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD and Comb MJ.
Journal Nat. Biotechnol. 23 (1), 94-101 (2005)
Title Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes .
Author Jansa P, Mason SW, Hoffmann-Rohrer U and Grummt I.
Journal EMBO J. 17 (10), 2855-2864 (1998)
Title Cloning and characterization of the human RNA polymerase I subunit hRPA40 .
Author Dammann R and Pfeifer GP.
Journal Biochim. Biophys. Acta 1396 (2), 153-157 (1998)
Title Constitutive and strong association of PAF53 with RNA polymerase I .
Author Seither P, Zatsepina O, Hoffmann M and Grummt I.
Journal Chromosoma 106 (4), 216-225 (1997)
Title Mouse RNA polymerase I 16-kDa subunit able to associate with 40-kDa subunit is a homolog of yeast AC19 subunit of RNA polymerases I and .
Author Yao Y, Yamamoto K, Nishi Y, Nogi Y and Muramatsu M.
Journal J. Biol. Chem. 271 (51), 32881-32885 (1996)
Title Treacher Collins Syndrome .
Author Katsanis,S.H. and Jabs,E.W.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.