• THAT   AND
  • THAT   AND


Homo sapiens polymerase (RNA) I polypeptide C, 30kDa (POLR1C), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_203290 Homo sapiens polymerase (RNA) I polypeptide C, 30kDa (POLR1C), mRNA. Full Lenth $392.37
ORF Sequence $301.89


RefSeq Version NM_203290.2, 327365362
Length 1353 bp
Structure linear
Update Date 09-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens polymerase (RNA) I polypeptide C, 30kDa (POLR1C), mRNA.
Product DNA-directed RNA polymerases I and III subunit RPAC1
Comment

Summary: The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Defects in this gene have been associated with Treacher Collins syndrome (TCS). [provided by RefSeq].

RefSeq NP_976035.1
CDS 72..1112
Exon (1)1..140
Exon (2)1..140
Exon (3)141..212
Exon (4)213..320
Exon (5)321..453
Exon (6)454..573
Exon (7)574..726
Exon (8)727..876
Exon (9)877..993
Exon (10)994..1325
Translation MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENS LEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPR LFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGN QADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDIT LLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLA RVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolPOLR1C
Gene SynonymRP3-337H4.4; RPA39; RPA40; RPA5; RPAC1; TCS3
Chromosome6
Locus Map6p21.1
All Transcripts NM_203290
Title Mutations in genes encoding subunits of RNA polymerases I and III cause Treacher Collins syndrome .
Author Dauwerse,J.G., Dixon,J., Seland,S., Ruivenkamp,C.A., van Haeringen,A., Hoefsloot,L.H., Peters,D.J., Boers,A.C., Daumer-Haas,C., Maiwald,R., Zweier,C., Kerr,B., Cobo,A.M., Toral,J.F., Hoogeboom,A.J., Lohmann,D.R., Hehr,U., Dixon,M.J., Breuning,M.H. and Wieczorek,D.
Journal Nat. Genet. 43 (1), 20-22 (2011)
Title hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes .
Author Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z., Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S., McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J., Dunham,I., Hill,D.E. and Vidal,M.
Journal Genomics 89 (3), 307-315 (2007)
Title Large-scale mapping of human protein-protein interactions by mass spectrometry .
Author Ewing,R.M., Chu,P., Elisma,F., Li,H., Taylor,P., Climie,S., McBroom-Cerajewski,L., Robinson,M.D., O'Connor,L., Li,M., Taylor,R., Dharsee,M., Ho,Y., Heilbut,A., Moore,L., Zhang,S., Ornatsky,O., Bukhman,Y.V., Ethier,M., Sheng,Y., Vasilescu,J., Abu-Farha,M., Lambert,J.P., Duewel,H.S., Stewart,I.I., Kuehl,B., Hogue,K., Colwill,K., Gladwish,K., Muskat,B., Kinach,R., Adams,S.L., Moran,M.F., Morin,G.B., Topaloglou,T. and Figeys,D.
Journal Mol. Syst. Biol. 3, 89 (2007)
Title Transcriptome analysis of human gastric cancer .
Author Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J., Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and Kim,N.S.
Journal Mamm. Genome 16 (12), 942-954 (2005)
Title Nucleolar proteome dynamics .
Author Andersen,J.S., Lam,Y.W., Leung,A.K., Ong,S.E., Lyon,C.E., Lamond,A.I. and Mann,M.
Journal Nature 433 (7021), 77-83 (2005)
Title Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning .
Author Mao,M., Fu,G., Wu,J.S., Zhang,Q.H., Zhou,J., Kan,L.X., Huang,Q.H., He,K.L., Gu,B.W., Han,Z.G., Shen,Y., Gu,J., Yu,Y.P., Xu,S.H., Wang,Y.X., Chen,S.J. and Chen,Z.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (14), 8175-8180 (1998)
Title Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes .
Author Jansa,P., Mason,S.W., Hoffmann-Rohrer,U. and Grummt,I.
Journal EMBO J. 17 (10), 2855-2864 (1998)
Title Cloning and characterization of the human RNA polymerase I subunit hRPA40 .
Author Dammann,R. and Pfeifer,G.P.
Journal Biochim. Biophys. Acta 1396 (2), 153-157 (1998)
Title Constitutive and strong association of PAF53 with RNA polymerase I .
Author Seither,P., Zatsepina,O., Hoffmann,M. and Grummt,I.
Journal Chromosoma 106 (4), 216-225 (1997)
Title Mouse RNA polymerase I 16-kDa subunit able to associate with 40-kDa subunit is a homolog of yeast AC19 subunit of RNA polymerases I and .
Author Yao,Y., Yamamoto,K., Nishi,Y., Nogi,Y. and Muramatsu,M.
Journal J. Biol. Chem. 271 (51), 32881-32885 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878