• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens polymerase (RNA) I polypeptide C, 30kDa (POLR1C), mRNA.


RefSeq Accession Definition Services Price Order
NM_203290 Homo sapiens polymerase (RNA) I polypeptide C, 30kDa (POLR1C), mRNA. ORF Sequence $301.89
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_203290.2, 327365362
Length 1353 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens polymerase (RNA) I polypeptide C, 30kDa (POLR1C), mRNA.
Product DNA-directed RNA polymerases I and III subunit RPAC1
Comment

Summary: The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Defects in this gene have been associated with Treacher Collins syndrome (TCS). [provided by RefSeq, Mar 2011].

RefSeq NP_976035.1
CDS 72..1112
Misc Feature(1)75..77
Misc Feature(2)75..77
Misc Feature(3)168..170
Misc Feature(4)216..1088
Misc Feature(5)order(216..224,237..242,264..266,276..278,282..287,
Misc Feature(6)252..1079
Misc Feature(7)order(291..293,300..305,315..317,375..377,381..386,
Misc Feature(8)order(336..356,378..380,393..395,732..737,741..743)
Misc Feature(9)order(369..371,396..398,405..407,570..572,576..578,
Exon (1)1..140
Gene:POLR1C
Gene Synonym:RP3-337H4.4; RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (2)141..212
Gene:POLR1C
Gene Synonym:RP3-337H4.4; RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (3)213..320
Gene:POLR1C
Gene Synonym:RP3-337H4.4; RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (4)321..453
Gene:POLR1C
Gene Synonym:RP3-337H4.4; RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (5)454..573
Gene:POLR1C
Gene Synonym:RP3-337H4.4; RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (6)574..726
Gene:POLR1C
Gene Synonym:RP3-337H4.4; RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (7)727..876
Gene:POLR1C
Gene Synonym:RP3-337H4.4; RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (8)877..993
Gene:POLR1C
Gene Synonym:RP3-337H4.4; RPA39; RPA40; RPA5; RPAC1; TCS3
Exon (9)994..1325
Gene:POLR1C
Gene Synonym:RP3-337H4.4; RPA39; RPA40; RPA5; RPAC1; TCS3
Translation MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENS LEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPR LFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGN QADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDIT LLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLA RVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
12+dbSNP:
12+a, cdbSNP:113801285
51+a, gdbSNP:190872536
57+c, tdbSNP:2231757
64+a, gdbSNP:142683244
68+c, tdbSNP:2231756
79+c, tdbSNP:138184356
93+a, gdbSNP:201071477
105+a, gdbSNP:200115914
108+c, tdbSNP:201754745
136+a, gdbSNP:149529196
150+dbSNP:
150+a, gdbSNP:144054843
187+c, tdbSNP:148236144
201+a, cdbSNP:186395114
264+dbSNP:
264+a, gdbSNP:141471029
318+c, gdbSNP:11544826
340+dbSNP:
340+a, gdbSNP:74604392
408+a, tdbSNP:55653636
429+c, tdbSNP:146332364
466+dbSNP:
466+a, gdbSNP:201320592
492+c, tdbSNP:148385032
514+a, gdbSNP:144195949
523+a, gdbSNP:146162408
560+c, tdbSNP:187997427
561+a, gdbSNP:200525225
581+dbSNP:
581+c, gdbSNP:140188270
621+c, gdbSNP:149840242
632+a, gdbSNP:145813943
668+c, tdbSNP:112689763
669+a, gdbSNP:148979835
680+g, tdbSNP:150870449
705+a, gdbSNP:79222964
759+dbSNP:
759+a, cdbSNP:79826982
833+c, tdbSNP:147793518
858+a, gdbSNP:200121299
906+dbSNP:
906+c, tdbSNP:141156009
907+a, gdbSNP:191582628
934+c, tdbSNP:146936712
988+a, gdbSNP:137871425
1009+dbSNP:
1009+c, tdbSNP:181576159
1096+c, tdbSNP:140888409
1115+c, tdbSNP:112057763
1142+c, tdbSNP:185499373
1204+g, tdbSNP:140085360
1215+c, tdbSNP:1127166
Gene SymbolPOLR1C
Gene SynonymRP3-337H4.4; RPA39; RPA40; RPA5; RPAC1; TCS3
Chromosome6
Locus Map6p21.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_203290 Homo sapiens polymerase (RNA) I polypeptide C, 30kDa (POLR1C), mRNA. Full Length $392.37
ORF Sequence $301.89
Title Mutations in genes encoding subunits of RNA polymerases I and III cause Treacher Collins syndrome .
Author Dauwerse,J.G., Dixon,J., Seland,S., Ruivenkamp,C.A., van Haeringen,A., Hoefsloot,L.H., Peters,D.J., Boers,A.C., Daumer-Haas,C., Maiwald,R., Zweier,C., Kerr,B., Cobo,A.M., Toral,J.F., Hoogeboom,A.J., Lohmann,D.R., Hehr,U., Dixon,M.J., Breuning,M.H. and Wieczorek,D.
Journal Nat. Genet. 43 (1), 20-22 (2011)
Title hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes .
Author Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z., Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S., McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J., Dunham,I., Hill,D.E. and Vidal,M.
Journal Genomics 89 (3), 307-315 (2007)
Title Transcriptome analysis of human gastric cancer .
Author Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J., Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and Kim,N.S.
Journal Mamm. Genome 16 (12), 942-954 (2005)
Title Nucleolar proteome dynamics .
Author Andersen,J.S., Lam,Y.W., Leung,A.K., Ong,S.E., Lyon,C.E., Lamond,A.I. and Mann,M.
Journal Nature 433 (7021), 77-83 (2005)
Title Immunoaffinity profiling of tyrosine phosphorylation in cancer cells .
Author Rush,J., Moritz,A., Lee,K.A., Guo,A., Goss,V.L., Spek,E.J., Zhang,H., Zha,X.M., Polakiewicz,R.D. and Comb,M.J.
Journal Nat. Biotechnol. 23 (1), 94-101 (2005)
Title Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning .
Author Mao,M., Fu,G., Wu,J.S., Zhang,Q.H., Zhou,J., Kan,L.X., Huang,Q.H., He,K.L., Gu,B.W., Han,Z.G., Shen,Y., Gu,J., Yu,Y.P., Xu,S.H., Wang,Y.X., Chen,S.J. and Chen,Z.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (14), 8175-8180 (1998)
Title Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes .
Author Jansa,P., Mason,S.W., Hoffmann-Rohrer,U. and Grummt,I.
Journal EMBO J. 17 (10), 2855-2864 (1998)
Title Cloning and characterization of the human RNA polymerase I subunit hRPA40 .
Author Dammann,R. and Pfeifer,G.P.
Journal Biochim. Biophys. Acta 1396 (2), 153-157 (1998)
Title Constitutive and strong association of PAF53 with RNA polymerase I .
Author Seither,P., Zatsepina,O., Hoffmann,M. and Grummt,I.
Journal Chromosoma 106 (4), 216-225 (1997)
Title Mouse RNA polymerase I 16-kDa subunit able to associate with 40-kDa subunit is a homolog of yeast AC19 subunit of RNA polymerases I and .
Author Yao,Y., Yamamoto,K., Nishi,Y., Nogi,Y. and Muramatsu,M.
Journal J. Biol. Chem. 271 (51), 32881-32885 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878