• THAT   AND
  • THAT   AND


Gallus gallus lysozyme (renal amyloidosis) (LYZ), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_205281 Gallus gallus lysozyme (renal amyloidosis) (LYZ), mRNA. Full Lenth $204.40
ORF Sequence $159.00
RefSeq Version NM_205281.1, 45384211
Length 584 bp
Structure linear
Update Date 12-MAR-2011
Organism Gallus gallus (chicken)
Definition Gallus gallus lysozyme (renal amyloidosis) (LYZ), mRNA.
Product lysozyme C precursor
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from V00428.1.

RefSeq NP_990612.1
CDS 28..471
Translation MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCVAKFESNFNTQA TNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDG NGMSAWVAWRNRCKGTDVQAWIRGCRL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolLYZ
Gene SynonymLYZC
Chromosome1
Locus Map1
All Transcripts NM_205281
Title Investigating the effects of sodium dodecyl sulfate on the aggregative behavior of hen egg-white lysozyme at acidic pH .
Author Hung,Y.T., Lin,M.S., Chen,W.Y. and Wang,S.S.
Journal Colloids Surf B Biointerfaces 81 (1), 141-151 (2010)
Title Consistent picture of the reversible thermal unfolding of hen egg-white lysozyme from experiment and molecular dynamics .
Author Meersman,F., Atilgan,C., Miles,A.J., Bader,R., Shang,W., Matagne,A., Wallace,B.A. and Koch,M.H.
Journal Biophys. J. 99 (7), 2255-2263 (2010)
Title DMSO-induced denaturation of hen egg white lysozyme .
Author Voets,I.K., Cruz,W.A., Moitzi,C., Lindner,P., Areas,E.P. and Schurtenberger,P.
Journal J Phys Chem B 114 (36), 11875-11883 (2010)
Title Slow molecular dynamics close to crystal surfaces during crystallization of a protein lysozyme studied by fluorescence correlation spectroscopy .
Author Tanaka,S.
Journal J Chem Phys 133 (9), 095103 (2010)
Title In situ muGISAXS: I. Experimental setup for submicron study of protein nucleation and growth .
Author Gebhardt,R., Pechkova,E., Riekel,C. and Nicolini,C.
Journal Biophys. J. 99 (4), 1256-1261 (2010)
Title Crystallographic refinement of the three-dimensional structure of the FabD1.3-lysozyme complex at 2.5-A resolution .
Author Fischmann,T.O., Bentley,G.A., Bhat,T.N., Boulot,G., Mariuzza,R.A., Phillips,S.E., Tello,D. and Poljak,R.J.
Journal J. Biol. Chem. 266 (20), 12915-12920 (1991)
Title Isolation of recombinant plasmids bearing cDNA to hen ovomucoid and lysozyme mRNAs .
Author Buell,G.N., Wickens,M.P., Carbon,J. and Schimke,R.T.
Journal J. Biol. Chem. 254 (18), 9277-9283 (1979)
Title Precursor of egg white lysozyme. Amino acid sequence of an NH2-terminal extension .
Author Palmiter,R.D., Gagnon,J., Ericsson,L.H. and Walsh,K.A.
Journal J. Biol. Chem. 252 (18), 6386-6393 (1977)
Title Structures of triclinic mono- and di-N-acetylglucosamine: lysozyme complexes--a crystallographic study .
Author Kurachi,K., Sieker,L.C. and Jensen,L.H.
Journal J. Mol. Biol. 101 (1), 11-24 (1976)
Title The structure of triclinic lysozyme at 2-5 A resolution .
Author Moult,J., Yonath,A., Traub,W., Smilansky,A., Podjarny,A., Rabinovich,D. and Saya,A.
Journal J. Mol. Biol. 100 (2), 179-195 (1976)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878