|
You are here:
Biology CRO for Drug Discovery » Molecular Biology Services » Custom ORF Cloning Services » ORF Detail
 |
Sus scrofa arginine vasopressin (AVP), mRNA.
| RefSeq Version | NM_213952.1, 47522733 |
| Length | 572 bp |
| Structure | linear |
| Update Date | 13-MAR-2011 |
| Organism | Sus scrofa (pig) |
| Definition | Sus scrofa arginine vasopressin (AVP), mRNA. |
| Product | vasopressin-neurophysin 2-copeptin precursor |
| Comment | COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from M25644.1. |
| RefSeq | NP_999117.1 |
| CDS | 46..546 |
| Translation | MPDATLPACFLGLLALTSACYFQNCPKGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCG
DELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGA
SFLRRARASDRSNATLLDGPSGALLLRLVQLAGAPEPAEPAQPGVY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| Title | Poly(A) tail length of oxytocin- and lysine vasopressin-encoding mRNAs increases during development in the porcine hypothalamus . |
| Author | Rehbein,M. and Richter,D. |
| Journal | J. Mol. Endocrinol. 4 (2), 151-158 (1990) |
| Title | The neurohypophyseal hormones vasopressin and oxytocin. Precursor structure, synthesis and regulation . |
| Author | Rehbein,M., Hillers,M., Mohr,E., Ivell,R., Morley,S., Schmale,H. and Richter,D. |
| Journal | Biol. Chem. Hoppe-Seyler 367 (8), 695-704 (1986) |
| Title | A new glycopeptide in pig, ox and sheep pituitary . |
| Author | Smyth,D.G. and Massey,D.E. |
| Journal | Biochem. Biophys. Res. Commun. 87 (4), 1006-1010 (1979) |
| Title | Characterization of porcine MSEL-neurophysin . |
| Author | Chauvet,M.T., Codogno,P., Chauvet,J. and Acher,R. |
| Journal | FEBS Lett. 71 (2), 291-293 (1976) |
| Title | Characterization of porcine neurophysin. III. Its resemblance and possible relationship to porcine neurophysin I . |
| Author | Wuu,T.C. and Crumm,S.E. |
| Journal | J. Biol. Chem. 251 (9), 2735-2739 (1976) |
| Title | A glycopeptide from the posterior lobe of pig pituitaries. 2. Primary structure . |
| Author | Holwerda,D.A. |
| Journal | Eur. J. Biochem. 28 (3), 340-346 (1972) |
| Title | Amino acid sequence of porcine neurophysin-I . |
| Author | Wuu,T.C., Crumm,S. and Saffran,M. |
| Journal | J. Biol. Chem. 246 (19), 6043-6063 (1971) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |