Sequence in raw or FASTA format:
PREDICTED: Pan troglodytes XIAP associated factor-1, transcript variant 2 (LOC455244), mRNA.
| RefSeq Version | XM_001168122.1, 114666051 |
| Length | 4181 bp |
| Structure | linear |
| Update Date | 16-SEP-2006 |
| Organism | Pan troglodytes (chimpanzee) |
| Definition | PREDICTED: Pan troglodytes XIAP associated factor-1, transcript variant 2 (LOC455244), mRNA. |
| Product | similar to XIAP associated factor-1 isoform 2 |
| Comment | COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_001226908) annotated using gene prediction method: GNOMON, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process |
| RefSeq | XP_001168122.1 |
| CDS | 510..1235 |
| Translation | MCQQSMQKSSLEFHKANECQERPVECKFCKLDMQLSKLELHESYCGSRTELCQGCGQFIM
HRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYCNQMIPENKYFHHMGKCCPDSEFKK
HFPVGKPKILPSSLPSQVAENQTSTMEKDVRPKTRSINRFPLHSESSSKKAPRSKNKTLD
PLLMSEPKPRTSSPRGDKAAYDILRRCSQCGILLPLPILNQHQEKCWWLASSKGKQVRNF
S
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| Gene Symbol | LOC455244 |
| Gene Synonym | LOC455244 |
| Chromosome | 17 |
| All Transcripts | XM_001168151 , XM_001167990 , XM_511986 , XM_001168122 |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
| Secured Online Quotation | |
| Email: gene@genscript.com | |
| Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 | |
| Fax: 1-732-210-0262 1-732-885-5878 |


