Sequence in raw or FASTA format:
PREDICTED: Monodelphis domestica brain-derived neurotrophic factor (BDNF), mRNA.
| RefSeq Version | XM_001368353.1, 126332213 |
| Length | 786 bp |
| Structure | linear |
| Update Date | 27-FEB-2007 |
| Organism | Monodelphis domestica (gray short-tailed opossum) |
| Definition | PREDICTED: Monodelphis domestica brain-derived neurotrophic factor (BDNF), mRNA. |
| Product | similar to brain-derived neurotrophic factor isoform c preproprotein |
| Comment | COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_001581970) annotated using gene prediction method: GNOMON. Also see: Documentation of NCBI's Annotation Process |
| RefSeq | XP_001368390.1 |
| CDS | 1..786 |
| Translation | METRDDLFFHQVRRVMTILFLTMVISYFGCMKAAPMKETSVRGQGSLAYPNMRTHGTLES
LNGPKAGSRGLTSLADTFEHVIEELLDEDQNVQPREENKDADLYTSRVMLSSQVPLEPPL
LFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTV
LEKVPVPKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDNKKRV
GWRFIRIDTSCVCTLTIKRGR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| Gene Symbol | BDNF |
| Gene Synonym | BDNF |
| Chromosome | 5 |
| All Transcripts | XM_001368353 |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
| Secured Online Quotation | |
| Email: gene@genscript.com | |
| Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 | |
| Fax: 1-732-210-0262 1-732-885-5878 |


