Culex quinquefasciatus conserved hypothetical protein, mRNA.
| RefSeq Version | XM_001841634.1, 170027601 |
| Length | 1249 bp |
| Structure | linear |
| Update Date | 01-DEC-2009 |
| Organism | Culex quinquefasciatus (southern house mosquito) |
| Definition | Culex quinquefasciatus conserved hypothetical protein, mRNA. |
| Product | hypothetical protein |
| Comment | COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_001886701). COMPLETENESS: incomplete on the 5' end. |
| RefSeq | XP_001841686.1 |
| CDS | 1..1077 |
| Translation | MISKGLAVVLAVTVVLAQISLSAAAPQFLTFKDGKFGVNFGGYHAEAGLGGLLTGNAAHG
GLSASAGTPHGQQAGAGLGGILDGNARTAGGLYAGATAGNGVGASAALGGGLNGEGGAGG
TGAEAHAGGISRKVVKLGQTNGAAPPSETILVHEVPPAPQSINTRFNHQEYDSNTRTKTF
VKEVYTDLEAPPAVQQPVQTRTKTIYKKKVITRPHKVAVVDSSYEQGVQAGGSVSNSVDL
NRFFDFQAFTNIAASFAHPAPIPSPSSSVFVEQEHHHDSEIQKEVHVKTRFDSNGHSGGG
STQTQTSTVNAGATLNSNFWNDIFNIPISTLSAVNQFLNNKSGSGSGTVHVHKHTEVH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| Gene Symbol | <1..>1249 |
| Gene Synonym | <1..>1249 |
| Chromosome | |
| All Transcripts | XM_001841634 |
| Title | Annotation of Culex pipiens quinquefasciatus . |
| Author | Atkinson,P.W., Hemingway,J., Christensen,B.M., Higgs,S., Kodira,C., Hannick,L., Megy,K., O'Leary,S., Pearson,M., Haas,B.J., Mauceli,E., Wortman,J.R., Lee,N.H., Guigo,R., Stanke,M., Alvarado,L., Amedeo,P., Antoine,C.H., Arensburger,P., Bidwell,S.L., Crawford,M., Camaro,F., Devon,K., Engels,R., Hammond,M., Howarth,C., Koehrsen,M., Lawson,D., Montgomery,P., Nene,V., Nusbaum,C., Puiu,D., Romero-Severson,J., Severson,D.W., Shumway,M., Sisk,P., Stolte,C., Zeng,Q., Eisenstadt,E., Fraser-Liggett,C., Strausberg,R., Galagan,J., Birren,B. and Collins,F.H. |
| Journal | Unpublished |
| Title | Direct Submission . |
| Author | Mauceli,E., Grabherr,M., Kodira,C., Lee,N.H., Wortman,J.R., Shumway,M., Atkinson,P.W., Severson,D.W., Arensburger,P., Collins,F.H., Hemingway,J., Romero-Severson,J., Tomkins,J.P., Nene,V., Johnson,J., Jaffe,D., Alvarez,P., Brockman,W., Butler,J., Gnerre,S., Kleber,M., MacCallum,I.A., Young,S., LaButti,K., Sykes,S., Berlin,A., Haas,B.J., Hannick,L., Puiu,D., Alvarado,L., Zeng,Q., Crawford,M., Antoine,C.H., O'Leary,S., Rogers,Y.-H., Utterback,T., Shetty,J., Viswanathan,L., Kravitz,S., Resnick,A., Devon,K., Nusbaum,C., Galagan,J., Eisenstadt,E., Fraser-Liggett,C. and Birren,B. |
| Journal | Submitted (26-MAR-2007) Broad Institute of MIT and Harvard, 7 Cambridge Center, Cambridge, MA 02142, USA |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |