Sequence in raw or FASTA format:
PREDICTED: Homo sapiens protein MOST-1-like (LOC100507249), mRNA.
| RefSeq Version | XM_003118604.1, 310120271 |
| Length | 2773 bp |
| Structure | linear |
| Update Date | 25-OCT-2010 |
| Organism | Homo sapiens (human) |
| Definition | PREDICTED: Homo sapiens protein MOST-1-like (LOC100507249), mRNA. |
| Product | protein MOST-1-like |
| Comment | COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NT_008046) annotated using gene prediction method: GNOMON, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process |
| RefSeq | XP_003118652.1 |
| CDS | 1115..1414 |
| Translation | MGECPHLVDVRLGHRSLATGPEQSDICHTGSEARWTTTWYGSLSFSRHKYKMLADLTPGV
EMSCRHWARWLTPVIPALWKAEAGGLPELRSSRPAWTTW
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| Gene Symbol | LOC100507249 |
| Gene Synonym | LOC100507249 |
| Chromosome | 8 |
| All Transcripts | XM_003118604 |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |