|
You are here:
Biology CRO for Drug Discovery » Molecular Biology Services » Custom ORF Cloning Services » ORF Detail
 |
PREDICTED: Pan troglodytes hypothetical LOC466447, transcript variant 2 (LOC466447), mRNA.
| RefSeq Version | XM_521846.2, 114636276 |
| Length | 853 bp |
| Structure | linear |
| Update Date | 15-SEP-2006 |
| Organism | Pan troglodytes (chimpanzee) |
| Definition | PREDICTED: Pan troglodytes hypothetical LOC466447, transcript variant 2 (LOC466447), mRNA. |
| Product | hypothetical protein isoform 2 |
| Comment | COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_001222274) annotated using gene prediction method: GNOMON, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Sep 15, 2006 this sequence version replaced gi:55635600. |
| RefSeq | XP_521846.1 |
| CDS | 50..493 |
| Translation | MGVCMCCFEPIVEIQRIGSDIICNNKRASLVKMIPAKDMAKVMIVMLAICFLTKSDGKSV
KKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDN
VLVESHEKSLGEADKADVNVLTKAKSQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| Gene Symbol | LOC466447 |
| Gene Synonym | LOC466447 |
| Chromosome | 11 |
| All Transcripts | XM_521846 , XM_001171819 |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |