β-Amyloid (1-40) - GenScript

Peptides&Biochemicals

24 hour

You are here: Products » Peptides&Biochemicals » Beta Amyloid Peptides » ?-Amyloid (1-40)

A B C D E F G H I J K L M N O P Q R S T U V W X Y Z Hot Products All Category

β-Amyloid (1-40)

Full Name

β-Amyloid (1-40)

Alias

amyloid peptide; amyloid beta protein; beta amyloid plaques

Documents
Document-MSDS: 6021_20080924024159.PDF (PDF)
Document-COA: 9335_20090209003754.PDF (PDF)
Document-HPLC: 12005_20100303224615.PDF (PDF)
Document-MS: 12006_20100303224646.PDF (PDF)
TECHNICAL MANUAL: 12464_20100407015038.PDF (PDF)
Document-COA: 107794_186840_1_COA_P10571209.pdf (PDF)
Document-COA: 199573_196943_1_COA_P16861211.pdf (PDF)
Document-COA: 25729_176225_2_COA_P13941206.pdf (PDF)
Document-COA: 823309_253280_1_COA_PX9861304.pdf (PDF)
Figures
Reference

Sequence
(one-letter code)

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Sequence
(three-letter code)

{ASP}{ALA}{GLU}{PHE}{ARG}{HIS}{ASP}{SER}{GLY}{TYR}{GLU}{VAL}{HIS}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}{ALA}{GLU}{ASP} {VAL}{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}{VAL}{GLY}{GLY}{VAL}{VAL}

Description

Beta-amyloid peptide (beta-APP) is a 40-residue peptide implicated in the pathogenesis of Alzheimer’s disease (AD) and aged Down's Syndrome, which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21. The peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain, followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region.

Solubility

Insoluble in water, may be dissolved in any buffer of pH >9.

Purity

> 95%

Storage

Store at -20°C

Notes

In culture, beta-amyloid peptide is neurotrophic to undifferentiated hippocampal neurons at low concentrations and neurotoxic to mature neurons at higher concentrations. In differentiated neurons, it causes dendritic and axonal retraction followed by neuronal death.

Related Products

Cat. No.	Name	Size	Price	Selected
RP10002-0.5	β-Amyloid (1-28)	0.500 mg	$81.00
RP10008-5	β-Amyloid (25-35)	5 mg	$209.00
RP10008-1	β-Amyloid (25-35)	1 mg	$52.00
RP10013-1	β-Amyloid (1-42), rat	1 mg	$309.00
RP10013-0.5	β-Amyloid (1-42), rat	0.500 mg	$176.00
RP10016-1	β-Amyloid (1-40), rat	1 mg	$271.00
RP10016-0.5	β-Amyloid (1-40), rat	0.500 mg	$157.00
RP10017-1	β-Amyloid (1-42), human	1 mg	$214.00
RP10017-0.5	β-Amyloid (1-42), human	0.500 mg	$119.00
RP10034-1	β-Amyloid (42-1)	1 mg	$475.00
RP10034-0.5	β-Amyloid (42-1)	0.500 mg	$285.00


1	Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2	Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. GenScript FlexPeptide^TM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3	Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (²H, ¹⁵N, and ¹³C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4	Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.

10% off peptide service