Catalog Products » Catalog Peptide » Brain Natriuretic Peptide (BNP) (1-32), human
Manual
COAs
HPLC
MS

Brain Natriuretic Peptide (BNP) (1-32), human

*This product has been discontinued!*
Brain natriuretic peptide (type B natriuretic peptide, BNP) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulatory system. BNP is involved in blood pressure control and cardiovascular homeostasis.
RP11119
Ask us a question
Synonyms Brain Natriuretic Peptide(1-32), human
Description Brain natriuretic peptide (type B natriuretic peptide, BNP) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulatory system. BNP is involved in blood pressure control and cardiovascular homeostasis.
Cas No 114471-18-0
Sequence
{SER}{PRO}{LYS}{MET}{VAL}{GLN}{GLY}{SER}{GLY}{CYS}{PHE}{GLY}
{ARG}{LYS}{MET}{ASP}{ARG}{ILE}{SER}{SER}{SER}{SER}{GLY}{LEU}
{GLY}{CYS}{LYS}{VAL}{LEU}{ARG}{ARG}{HIS}
Sequence Shortening SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
Molecular Formula C143H244N50O42S4
Disulfide Bridge Cys10-Cys26
Molecular Weight 3464.1
Back

Purity > 95%
Solubility The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Form Lyophilized
Storage Store the peptide at -20°C. Use recommended within 6 months.
Back