| |
Parathyroid Hormone (PTH) (1-34), Human  |
|
|
| Cat. No. |
Size |
Price |
Figures |
|---|
RP01001-0.5 mg
| 0.5 mg | $ 80.00 | MSDS: 20080923234956 (PDF)
STRUCTURE:
Zoom
References:
- Iida-Klein A, et al. Effects of cyclic versus daily hPTH(1-34) regimens on bone strength in association with BMD, biochemical markers, and bone structure in mice. J Bone Miner Res. Feb 2006;21(2):274-282.
- Shao JS, et al. Teriparatide (human parathyroid hormone (1-34)) inhibits osteogenic vascular calcification in diabetic low density lipoprotein receptor-deficient mice. J Biol Chem. Dec 12 2003;278(50):50195-50202.
- Hurley MM, et al. Impaired bone anabolic response to parathyroid hormone in Fgf2-/- and Fgf2+/- mice. Biochem Biophys Res Commun. Mar 24 2006;341(4):989-994.
|
|---|
| Full Name | | Parathyroid Hormone (PTH) (1-34), Human |
|
| Alias |
PTH 1-34 |
Sequence
(one-letter code) |
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF | Sequence
(three-letter code) | {SER}{VAL}{SER}{GLU}{ILE}{GLN}{LEU}{MET}{HIS}{ASN}
{LEU}{GLY}{LYS}{HIS}{LEU}{ASN}{SER}{MET}{GLU}{ARG}
{VAL}{GLU}{TRP}{LEU}
{ARG}{LYS}{LYS}{LEU}{GLN}{ASP}{VAL}
{HIS}{ASN}{PHE} |
|---|
| Description | Parathyroid Hormone (PTH) (1-34) (Human) is a highly purified peptide chemically synthesized by GenScript. Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Parathyroid hormone accomplishes its job by stimulating at least three processes: mobilization of calcium from bone, enhancing absorption of calcium from the small intestine, suppression of calcium loss in urine. PTH (1-34) is a peptide fragment (34 amino acids) of the naturally occurring human parathyroid hormone that is an important regulator of calcium and phosphorus metabolism. |
|---|
| Solubility | Parathyroid Hormone (PTH) (1-34) (Human) is soluble in water. |
|---|
| Formula | C181H291N55O51S2 |
|---|
| M.W. | 4117.74 |
|---|
| Cas | 52232-67-4 |
|---|
| Purity | > 95% |
|---|
| Storage | Before using, store the peptide (PTH) in the DRY form at 4°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. |
| * For Non-Clinical Research Use Only *
 |
1 |
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
|
2 |
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
|
3 |
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
|
4 |
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.
|
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|
