| Cat. No. |
Size |
Price |
Figures |
|---|
RP01001-0.5 mg
| 0.5 mg | $ 80.00 | MSDS: 20080923234956 (PDF)
STRUCTURE:
Zoom
References:
- Iida-Klein A, et al. Effects of cyclic versus daily hPTH(1-34) regimens on bone strength in association with BMD, biochemical markers, and bone structure in mice. J Bone Miner Res. Feb 2006;21(2):274-282.
- Shao JS, et al. Teriparatide (human parathyroid hormone (1-34)) inhibits osteogenic vascular calcification in diabetic low density lipoprotein receptor-deficient mice. J Biol Chem. Dec 12 2003;278(50):50195-50202.
- Hurley MM, et al. Impaired bone anabolic response to parathyroid hormone in Fgf2-/- and Fgf2+/- mice. Biochem Biophys Res Commun. Mar 24 2006;341(4):989-994.
|
|---|
| Full Name | | Parathyroid Hormone (PTH) (1-34), Human |
|
| Alias |
PTH 1-34 |
Sequence
(one-letter code) |
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
Sequence
(three-letter code) | {SER}{VAL}{SER}{GLU}{ILE}{GLN}{LEU}{MET}{HIS}{ASN}
{LEU}{GLY}{LYS}{HIS}{LEU}{ASN}{SER}{MET}{GLU}{ARG}
{VAL}{GLU}{TRP}{LEU}
{ARG}{LYS}{LYS}{LEU}{GLN}{ASP}{VAL}
{HIS}{ASN}{PHE} |
|---|
| Description | Parathyroid Hormone (PTH) (1-34) (Human) is a highly purified peptide chemically synthesized by GenScript. Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Parathyroid hormone accomplishes its job by stimulating at least three processes: mobilization of calcium from bone, enhancing absorption of calcium from the small intestine, suppression of calcium loss in urine. PTH (1-34) is a peptide fragment (34 amino acids) of the naturally occurring human parathyroid hormone that is an important regulator of calcium and phosphorus metabolism. |
|---|
| Solubility | Parathyroid Hormone (PTH) (1-34) (Human) is soluble in water. |
|---|
| Formula | C181H291N55O51S2 |
|---|
| M.W. | 4117.74 |
|---|
| Cas | 52232-67-4 |
|---|
| Purity | > 95% |
|---|
| Storage | Before using, store the peptide (PTH) in the DRY form at 4°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. |
