You are here:  Products » Peptides&Biochemicals » Beta Amyloid Peptides »  β-Amyloid (1-40)   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
β-Amyloid (1-40)

Cat. No. Size Price Figures
RP10004-0.5 mg
0.5 mg
$ 114.00
MSDS:  20080924024159  (PDF)
COA:  β-Amyloid (1-40)  (PDF)
HPLC:  20100303224615  (PDF)
MS:  20100303224646  (PDF)
PROTOCOL:  20100407015038  (PDF)


References:
  • Richardson JS, et al. Free radicals in the neurotoxic actions of beta-amyloid. Ann N Y Acad Sci. Jan 17 1996;777:362-367.
  • McLaurin J, Chakrabartty A. Characterization of the interactions of Alzheimer beta-amyloid peptides with phospholipid membranes. Eur J Biochem. Apr 15 1997;245(2):355-363.
  • Hoglund K, et al. Plasma levels of beta-amyloid(1-40), beta-amyloid(1-42), and total beta-amyloid remain unaffected in adult patients with hypercholesterolemia after treatment with statins. Arch Neurol. Mar 2004;61(3):333-337.
RP10004-1 mg
1 mg
$ 190.00
Full Name
β-Amyloid (1-40)
Alias amyloid peptide; amyloid beta protein; beta amyloid plaques
Sequence
(one-letter code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(three-letter code)
{ASP}{ALA}{GLU}{PHE}{ARG}{HIS}{ASP}{SER}{GLY}{TYR}
{GLU}{VAL}{HIS}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}
{ALA}{GLU}{ASP} {VAL}{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}
{ILE}{GLY}{LEU}{MET}{VAL}{GLY}{GLY}{VAL}{VAL}
DescriptionBeta-amyloid peptide (beta-APP) is a 40-residue peptide implicated in the pathogenesis of Alzheimer’s disease (AD) and aged Down's Syndrome, which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21. The peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain, followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region.
SolubilityInsoluble in water, may be dissolved in any buffer of pH >9.
FormulaC194H295N53O58S1
M.W.4329.82
Cas131438-79-4
Purity> 95%
StorageStore at -20°C
NotesIn culture, beta-amyloid peptide is neurotrophic to undifferentiated hippocampal neurons at low concentrations and neurotoxic to mature neurons at higher concentrations. In differentiated neurons, it causes dendritic and axonal retraction followed by neuronal death.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10002peptide : β-Amyloid (1-28)0.5 mg
$ 81.00
RP10008 peptide : β-Amyloid (25-35)1 mg
$ 52.00
5 mg
$ 209.00
RP10013peptide : β-Amyloid (1-42), rat0.5 mg
$ 176.00
1 mg
$ 309.00
RP10016 peptide : β-Amyloid (1-40), rat0.5 mg
$ 157.00
1 mg
$ 271.00
RP10017peptide : β-Amyloid (1-42), human0.5 mg
$ 119.00
1 mg
$ 214.00
RP10034 peptide : β-Amyloid (42-1)0.5 mg
$ 285.00
1 mg
$ 475.00
GN001027ORF Clone : APP10 ug
$ 803.24
GN029425 ORF Clone : APP10 ug
$ 819.77
GN029426ORF Clone : APP10 ug
$ 754.52
GN046871 ORF Clone : APP10 ug
$ 1051.07




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.