Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  β-Amyloid (1-42), rat   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
β-Amyloid (1-42), rat

Cat. No. Size Price Figures
RP10013-0.5 mg
 		0.5 mg
$ 176.00
MSDS:  20080923035917  (PDF)


References:
  • Folin M, et al. Apolipoprotein-E modulates the cytotoxic effect of beta-amyloid on rat brain endothelium in an isoform-dependent specific manner. Int J Mol Med. May 2006;17(5):821-826.
  • Chen L, et al. alpha7 Nicotinic acetylcholine receptor as a target to rescue deficit in hippocampal LTP induction in beta-amyloid infused rats. Neuropharmacology. Feb 2006;50(2):254-268.
  • Bastianetto S, et al. Neuroprotective effects of green and black teas and their catechin gallate esters against beta-amyloid-induced toxicity. Eur J Neurosci. Jan 2006;23(1):55-64.
Full Name
β-Amyloid (1-42), rat
Alias Abeta 1-42, rat, β-Amyloid Peptide; βAmyloid Peptide; b-Amyloid Peptide; bAmyloid Peptide; beta-Amyloid Peptide; betaAmyloid Peptide
Sequence
(one-letter code)		 DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(three-letter code)		{ASP}{ALA}{GLU}{PHE}{GLY}{HIS}{ASP}{SER}{GLY}{PHE}
{GLU}{VAL}{ARG}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}
{ALA}{GLU}{ASP}{VAL}{GLY}{SER}{ASN}{LYS}{GLY}{ALA}
{ILE}{ILE}{GLY}{LEU}{MET}{VAL}{GLY}{GLY}{VAL}{VAL}
{ILE}{ALA}
DescriptionAbeta 1-42 induces a strong membrane destabilization in giant unilamellar vesicles composed of palmitoyloleoyl-phosphatidylcholine, sphingomyelin, and cholesterol, lowering the critical tension of vesicle rupture. Additionally, Abeta 1-42 triggers the induction of sequential leakage of low- and high-molecular-weight markers trapped inside the giant unilamellar vesicles, but preserving the vesicle shape. The Abeta 1-42 sequence confers particular molecular properties to the peptide that, in turn, influence supramolecular properties associated with membranes that may result in toxicity,including: 1) the ability of the peptide to strongly associate with the membrane; 2) a reduction of lateral membrane cohesive forces; and 3) a capacity to break the transbilayer gradient and puncture sealed vesicles.
FormulaC199H307N53O59S1
M.W.4418.1
Purity> 95%
StorageStore at -20°C.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10002peptide : β-Amyloid (1-28)0.5 mg
$ 81.00
RP10008 peptide : β-Amyloid (25-35)1 mg
$ 52.00
5 mg
$ 209.00
RP10017peptide : β-Amyloid (1-42), human0.5 mg
$ 119.00
RP10016 peptide : β-Amyloid (1-40), rat0.5 mg
$ 157.00
RP10004peptide : β-Amyloid (1-40)0.5 mg
$ 114.00
GN072628 ORF Clone : App10 ug
$ 2610.00
GN079047ORF Clone : App10 ug
$ 2891.00




1
 Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
 Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
 Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
 Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.