A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
VIP, guinea pig

Cat. No. Size Price Figures
RP10084-0.5 mg
0.5 mg
$ 81.00
MSDS:  20080626033104  (PDF)
PROTOCOL:  20100407015038  (PDF)


References:
  • Teng BQ, et al. Identification of a VIP-specific receptor in guinea pig tenia coli. Am. J. Physiol. Gastrointest. Liver Physiol. Sep 2001; 281(3): G718-G725.
  • Zawilska JB, et al. Receptors for VIP and PACAP in guinea pig cerebral cortex: effects on cyclic AMP synthesis and characterization by 125I-VIP binding. J. Mol. Neurosci. Jan 2005; 25(3): 215-224.
  • Kokubo A, et al. Restoration by VIP of the carbachol-stimulated Cl- secretion in TTX-treated guinea pig distal colon. Jpn. J. Physiol. Dec 2005; 55(6): 317-324.
Full Name
VIP, guinea pig
Alias VIP
Sequence
(one-letter code)
HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2
Sequence
(three-letter code)
{HIS}{SER}{ASP}{ALA}{LEU}{PHE}{THR}{ASP}{THR}{TYR}
{THR}{ARG}{LEU}{ARG}{LYS}{GLN}{MET}{ALA}{MET}{LYS}
{LYS}{TYR}{LEU}{ASN}{SER}{VAL}{LEU}{ASN}-NH2
C-TerminalNH2
DescriptionPeptide VIP is a vasodilator, bronchodilator and smooth muscle relaxant. Like PACAP, a closely related peptide, VIP is largely inhibitory in the gastrointestinal tract and its neuroprotective actions are mediated by the release of activity-dependent neurotrophic factors from glial cells. To characterize the effects of VIP on both contraction and relaxation of guinea pig gallbladder (GPGB) muscle, cumulative additions of VIP was performed with strips at basal tone or with strips pre-contracted with cholecystokinin-octapeptid, and VIP had no effect on basal tone.
FormulaC147H239N43O42S2
M.W.3344.9
Purity> 95%
Storage-20°C
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10085peptide : VIP, human, ovine, porcine, rat0.5 mg
$ 62.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.