| |
VIP, human, ovine, porcine, rat  |
|
|

| Cat. No. |
Size |
Price |
Figures |
RP10085-0.5 mg
| 0.5 mg | $ 62.00 | HPLC: 20060721145613 (PDF) MS: 20060721145553 (PDF) DATASHEET: 20080130042049 (DOC) MSDS: 20080626034529 (PDF) PROTOCOL: 20100407015038 (PDF) STRUCTURE:
 Zoom
References:
- Robberecht P, et al. PACAP and VIP receptors in rat liver membranes. Am. J. Physiol. Jan 1991; 260(1 Pt 1): G97-G102.
- Horikawa R, et al. Molecular cloning of ovine and bovine growth hormone-releasing hormone receptors: the ovine receptor is C-terminally truncated. Endocrinology. Jun 2001; 142(6): 2660-2668.
- Flemstrom G, et al. Short fasting dramatically decreases rat duodenal secretory responsiveness to orexin A but not to VIP or melatonin. Am. J. Physiol. Gastrointest. Liver Physiol. Dec 2003; 285(6): G1091-G1096.
|
|---|
| Full Name | | VIP, human, ovine, porcine, rat |
|
Sequence (one-letter code) |
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 | Sequence (three-letter code) | {HIS}{SER}{ASP}{ALA}{VAL}{PHE}{THR}{ASP}{ASN}{TYR} {THR}{ARG}{LEU}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS} {LYS}{TYR}{LEU}{ASN}{SER}{ILE}{LEU}{ASN}-NH2 | | C-Terminal | NH2 |
|---|
| Description | Peptide VIP is a Neuropeptide that is widely distributed in the central and peripheral nervous systems; Peptide VIP is a vasodilator, bronchodilator and smooth muscle relaxant. Peptide VIP modulates the activity of many immune system cell types. VIP is a mitogen for embryonic sympathetic neurons and its neuroprotective actions are mediated by the release of activity-dependent neurotrophic factors from glial cells. |
|---|
| Solubility | Soluble in water (1 mg/ml), colorless |
|---|
| Formula | C147H238N44O42S | | M.W. | 3325.8 | | Cas | 40077-57-4 |
|---|
| Purity | > 95% | | Storage | Store at -20°C. Keep tightly closed. |
| * For Non-Clinical Research Use Only *
 |
1 |
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
|
2 |
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
|
3 |
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
|
4 |
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.
|
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|