You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  VIP, human, ovine, porcine, rat   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
VIP, human, ovine, porcine, rat

Cat. No. Size Price Figures
RP10085-0.5 mg
0.5 mg
$ 62.00
HPLC:  20060721145613  (PDF)
MS:  20060721145553  (PDF)
DATASHEET:  20080130042049  (DOC)
MSDS:  20080626034529  (PDF)

STRUCTURE:
VIP, human, ovine, porcine, rat Structure
Zoom

References:
  • Robberecht P, et al. PACAP and VIP receptors in rat liver membranes. Am. J. Physiol. Jan 1991; 260(1 Pt 1): G97-G102.
  • Horikawa R, et al. Molecular cloning of ovine and bovine growth hormone-releasing hormone receptors: the ovine receptor is C-terminally truncated. Endocrinology. Jun 2001; 142(6): 2660-2668.
  • Flemstrom G, et al. Short fasting dramatically decreases rat duodenal secretory responsiveness to orexin A but not to VIP or melatonin. Am. J. Physiol. Gastrointest. Liver Physiol. Dec 2003; 285(6): G1091-G1096.
Full Name
VIP, human, ovine, porcine, rat
Sequence
(one-letter code)
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Sequence
(three-letter code)
{HIS}{SER}{ASP}{ALA}{VAL}{PHE}{THR}{ASP}{ASN}{TYR}
{THR}{ARG}{LEU}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}
{LYS}{TYR}{LEU}{ASN}{SER}{ILE}{LEU}{ASN}-NH2
C-TerminalNH2
DescriptionPeptide VIP is a Neuropeptide that is widely distributed in the central and peripheral nervous systems; Peptide VIP is a vasodilator, bronchodilator and smooth muscle relaxant. Peptide VIP modulates the activity of many immune system cell types. VIP is a mitogen for embryonic sympathetic neurons and its neuroprotective actions are mediated by the release of activity-dependent neurotrophic factors from glial cells.
SolubilitySoluble in water (1 mg/ml), colorless
FormulaC147H238N44O42S
M.W.3325.8
Cas40077-57-4
Purity> 95%
StorageStore at -20°C. Keep tightly closed.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10084peptide : VIP, guinea pig0.5 mg
$ 81.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.