| Cat. No. |
Size |
Price |
Figures |
|---|
RP10094-0.5 mg
| 0.5 mg | $ 118.75 | HPLC: 20060721145613 (PDF)
MS: 20060721145553 (PDF)
MSDS: 20080624042643 (PDF)
References:
- Le Mevel JC, et al. Cardiovascular actions of the stress-related neurohormonal peptides, corticotropin-releasing factor and urotensin-I in the trout Oncorhynchus mykiss. Gen. Comp. Endocrinol. Mar 2006; 146(1): 56-61.
- Craig PM, et al. Differential increase in forebrain and caudal neurosecretory system corticotropin-releasing factor and urotensin I gene expression associated with seawater transfer in rainbow trout. Endocrinology. Sep 2005; 146(9): 3851-3860.
- Lu W, et al. Coexpression of corticotropin-releasing hormone and urotensin i precursor genes in the caudal neurosecretory system of the euryhaline flounder (Platichthys flesus): a possible shared role in peripheral regulation. Endocrinology. Dec 2004; 145(12): 5786-5797.
|
|---|
| Full Name | |
| Alias |
U I, UrotensinI; Urotensin 1; Urotensin1 |
Sequence
(one-letter code) |
NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV |
Sequence
(three-letter code) | {ASN}{ASP}{ASP}{PRO}{PRO}{ILE}{SER}{ILE}{ASP}{LEU}
{THR}{PHE}{HIS}{LEU}{LEU}{ARG}{ASN}{MET}{ILE}{GLU}
{MET}{ALA}{ARG}{ILE}{GLU}{ASN}{GLU}{ARG}{GLU}{GLN}
{ALA}{GLY}{LEU}{ASN}{ARG}{LYS}{TYR}{LEU}{ASP}{GLU}
{VAL} |
|---|
| C-Terminal | NH2 |
|---|
| Description | Urotensins are neuropeptide secreted from the urophysis in the caudal neurosecretory system of the fishes. Two bioactive Urotensins, Urotensin I and Urotensin II have been cloned from various species including mammals. Urotensin I is a 41 aa peptide, which showed prolonged hypotensive effects in mammals. Urotensin I is structurally similar to mammalian corticotropin-releasing factor. Urotensin I is found in the brain of most fish species. It may be involved in the regulation of blood pressure in fish. Urotensin I is closely related to mammalian urocortin and releases ACTH from cultured rat pituitary cells. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
|---|
| Formula | C210H340N62O67S2 |
|---|
| M.W. | 4869.45 |
|---|
| Cas | 83930-33-0 |
|---|
| Purity | > 95% |
|---|
| Storage | Before using, store the peptide in the DRY form at 0-5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. |
