A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Urotensin I

Cat. No. Size Price Figures
RP10094-0.5 mg
0.5 mg
$ 119.00
HPLC:  20060721145613  (PDF)
MS:  20060721145553  (PDF)
MSDS:  20080624042643  (PDF)
PROTOCOL:  20100407015038  (PDF)


References:
  • Le Mevel JC, et al. Cardiovascular actions of the stress-related neurohormonal peptides, corticotropin-releasing factor and urotensin-I in the trout Oncorhynchus mykiss. Gen. Comp. Endocrinol. Mar 2006; 146(1): 56-61.
  • Craig PM, et al. Differential increase in forebrain and caudal neurosecretory system corticotropin-releasing factor and urotensin I gene expression associated with seawater transfer in rainbow trout. Endocrinology. Sep 2005; 146(9): 3851-3860.
  • Lu W, et al. Coexpression of corticotropin-releasing hormone and urotensin i precursor genes in the caudal neurosecretory system of the euryhaline flounder (Platichthys flesus): a possible shared role in peripheral regulation. Endocrinology. Dec 2004; 145(12): 5786-5797.
Full Name
Urotensin I
Alias U I, UrotensinI; Urotensin 1; Urotensin1
Sequence
(one-letter code)
NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2
Sequence
(three-letter code)
{ASN}{ASP}{ASP}{PRO}{PRO}{ILE}{SER}{ILE}{ASP}{LEU}
{THR}{PHE}{HIS}{LEU}{LEU}{ARG}{ASN}{MET}{ILE}{GLU}
{MET}{ALA}{ARG}{ILE}{GLU}{ASN}{GLU}{ARG}{GLU}{GLN}
{ALA}{GLY}{LEU}{ASN}{ARG}{LYS}{TYR}{LEU}{ASP}{GLU}
{VAL}-NH2
C-TerminalNH2
DescriptionUrotensins are neuropeptide secreted from the urophysis in the caudal neurosecretory system of the fishes. Two bioactive Urotensins, Urotensin I and Urotensin II have been cloned from various species including mammals. Urotensin I is a 41 aa peptide, which showed prolonged hypotensive effects in mammals. Urotensin I is structurally similar to mammalian corticotropin-releasing factor. Urotensin I is found in the brain of most fish species. It may be involved in the regulation of blood pressure in fish. Urotensin I is closely related to mammalian urocortin and releases ACTH from cultured rat pituitary cells.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC210H340N62O67S2
M.W.4869.45
Cas83930-33-0
Purity> 95%
StorageBefore using, store the peptide in the DRY form at 0-5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10096peptide : Urotensin II, human0.5 mg
$ 62.00
RP12919 peptide : Urotensin II, frog0.5 mg
$ 238.00
RP12920peptide : Urotensin II, mouse0.1 mg
$ 332.00
GN030186 ORF Clone : UTS2R10 ug
$ 488.30




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.