You are here:  Products » Peptides&Biochemicals » Catalog Peptides - Hot Products »  Urocortin III, human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Urocortin III, human

Cat. No. Size Price Figures
RP10100-0.5 mg
0.5 mg
$ 166.00
HPLC:  20060721145613  (PDF)
MS:  20060721145553  (PDF)
COA:  RP10100  (PDF)
MSDS:  20080626043353  (PDF)
PROTOCOL:  20100407015038  (PDF)


References:
  • Takahashi K, et al. Expression of urocortin III/stresscopin in human heart and kidney. J. Clin. Endocrinol. Metab. Apr 2004; 89(4): 1897-1903.
  • Aggelidou E, et al. Up-regulation of nitric oxide synthase and modulation of the guanylate cyclase activity by corticotropin-releasing hormone but not urocortin II or urocortin III in cultured human pregnant myometrial cells. Proc. Natl. Acad. Sci. U.S.A. Mar 2002; 99(5): 3300-3305.
  • Lewis K, et al. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Proc. Natl. Acad. Sci. U.S.A. Jun 2001; 98(13): 7570-7575.
Full Name
Urocortin III, human
Alias UrocortinIII; UCN 3; UCN3
Sequence
(one-letter code)
FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2
Sequence
(three-letter code)
{PHE}{THR}{LEU}{SER}{LEU}{ASP}{VAL}{PRO}{THR}{ASN}
{ILE}{MET}{ASN}{LEU}{LEU}{PHE}{ASN}{ILE}{ALA}{LYS}
{ALA}{LYS}{ASN}{LEU}{ARG}{ALA}{GLN}{ALA}{ALA}{ALA}
{ASN}{ALA}{HIS}{LEU}{MET}{ALA}{GLN}{ILE}-NH2
C-TerminalNH2
DescriptionUrocortin III (human) is a highly selective ligand for the CRF-II receptor. The amino acid sequence of the urocortin III peptide corresponds to amino acids 3-40 of stresscopin (human).
SolubilityInsoluble in water. Dissolve peptide with 100-200 µl of DMSO then dilute up with desired buffer.
FormulaC185H307N53O50S2
M.W.4137.93
Purity> 95%
StorageStore at -20°C. Keep tightly closed.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10098peptide : Urocortin II, human0.5 mg
$ 166.00
RP10099 peptide : Urocortin II, mouse0.5 mg
$ 166.00
RP10101peptide : Urocortin III, mouse0.5 mg
$ 166.00
RP10103 peptide : Urocortin, human0.5 mg
$ 119.00
RP10104peptide : Urocortin, rat0.5 mg
$ 109.00
GN017219 ORF Clone : UCN310 ug
$ 308.00
GN037271ORF Clone : UCN310 ug
$ 308.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.