Home | My Account | Place Order | Contact | Overview
Home »  Products »  Peptide Products »  Peptide Catalog » Urocortin III, human
 
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence :(eg.NLGKHLNSMERVEWL)
(One letter code)
Search by Sequence :(eg.{GLU}{ILE}{GLN}{LEU}{MET})
(Three letter code)

 
Urocortin III, human

Cat. No. Size Price Figures
RP10100-0.5 mg
 		0.5 mg
$ 166.25
HPLC:  20060721145613  (PDF)
MS:  20060721145553  (PDF)
COA:  20080229020741  (PDF)
MSDS:  20080626043353  (PDF)


References:
  • Takahashi K, et al. Expression of urocortin III/stresscopin in human heart and kidney. J. Clin. Endocrinol. Metab. Apr 2004; 89(4): 1897-1903.
  • Aggelidou E, et al. Up-regulation of nitric oxide synthase and modulation of the guanylate cyclase activity by corticotropin-releasing hormone but not urocortin II or urocortin III in cultured human pregnant myometrial cells. Proc. Natl. Acad. Sci. U.S.A. Mar 2002; 99(5): 3300-3305.
  • Lewis K, et al. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Proc. Natl. Acad. Sci. U.S.A. Jun 2001; 98(13): 7570-7575.
Full Name
Urocortin III, human
Alias UrocortinIII; UCN 3; UCN3
Sequence
(one-letter code)		 FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2
Sequence
(three-letter code)		{PHE}{THR}{LEU}{SER}{LEU}{ASP}{VAL}{PRO}{THR}{ASN}
{ILE}{MET}{ASN}{LEU}{LEU}{PHE}{ASN}{ILE}{ALA}{LYS}
{ALA}{LYS}{ASN}{LEU}{ARG}{ALA}{GLN}{ALA}{ALA}{ALA}
{ASN}{ALA}{HIS}{LEU}{MET}{ALA}{GLN}{ILE}-NH2
C-TerminalNH2
DescriptionUrocortin III (human) is a highly selective ligand for the CRF-II receptor. The amino acid sequence of the urocortin III peptide corresponds to amino acids 3-40 of stresscopin (human).
SolubilityInsoluble in water. Dissolve peptide with 100-200 µl of DMSO then dilute up with desired buffer.
FormulaC185H307N53O50S2
M.W.4137.93
Purity> 95%
StorageStore at -20°C. Keep tightly closed.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10098peptide : Urocortin II, human0.5 mg
$ 166.25
RP10099 peptide : Urocortin II, mouse0.5 mg
$ 166.25
RP10101peptide : Urocortin III, mouse0.5 mg
$ 166.25
RP10103 peptide : Urocortin, human0.5 mg
$ 118.75
RP10104peptide : Urocortin, rat0.5 mg
$ 109.25
GN017219 ORF Clone : UCN310 ug
$ 607.50
GN037271ORF Clone : UCN310 ug
$ 607.50



If you cannot find your peptides on our list, try our Express PeptideTM Service, and receive high-quality peptides in eight business days, guaranteed.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.