Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Urocortin III, mouse   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Urocortin III, mouse

Cat. No. Size Price Figures
RP10101-0.5 mg
 		0.5 mg
$ 166.25
HPLC:  20060721145613  (PDF)
MS:  20060721145553  (PDF)


References:
  • Venihaki M, et al. Urocortin III, a brain neuropeptide of the corticotropin-releasing hormone family: modulation by stress and attenuation of some anxiety-like behaviours. J. Neuroendocrinol. May 2004; 16(5): 411-422.
  • Jahn O, et al. Three-amino acid motifs of urocortin II and III determine their CRF receptor subtype selectivity. Neuropharmacology. Aug 2004; 47(2): 233-242.
Full Name
Urocortin III, mouse
Alias Ucn III; UcnIII; Ucn 3; Ucn3, UrocortinIII; Urocortin 3; Urocortin3; LOC498791 Peptide
Sequence
(one-letter code)		 FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
Sequence
(three-letter code)		{PHE}{THR}{LEU}{SER}{LEU}{ASP}{VAL}{PRO}{THR}{ASN}
{ILE}{MET}{ASN}{ILE}{LEU}{PHE}{ASN}{ILE}{ASP}{LYS}
{ALA}{LYS}{ASN}{LEU}{ARG}{ALA}{LYS}{ALA}{ALA}{ALA}
{ASN}{ALA}{GLN}{LEU}{MET}{ALA}{GLN}{ILE}-NH2
C-TerminalNH2
DescriptionMouse UcnIII is expressed predominantly in regions of the brain known to be involved in stress-related behaviours, and its expression in the hypothalamus increases following restraint.
SolubilityInsoluble in water. Dissolve peptide with 100-200 ml of DMSO then dilute up with desired buffer.
FormulaC186H312N52O52S2
M.W.4172.97
Cas357952-10-4
Purity> 95%
StorageStore at -20°C
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10098peptide : Urocortin II, human0.5 mg
$ 166.25
RP10099 peptide : Urocortin II, mouse0.5 mg
$ 166.25
RP10100peptide : Urocortin III, human0.5 mg
$ 166.25
RP10103 peptide : Urocortin, human0.5 mg
$ 118.75
RP10104peptide : Urocortin, rat0.5 mg
$ 109.25
GN084801 ORF Clone : Ucn310 ug
$ 618.75



If you cannot find your peptides on our list, try our Express PeptideTM Service, and receive high-quality peptides in eight business days, guaranteed.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.