Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Stresscopin, human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Stresscopin, human

Cat. No. Size Price Figures
RP10214-0.5 mg
 		0.5 mg
$ 185.25
HPLC:  20060721145614  (PDF)
MS:  20060721145554  (PDF)
MSDS:  20080626233356  (PDF)


References:
  • Takahashi K, et al. Expression of urocortin III/stresscopin in human heart and kidney. J Clin Endocrinol Metab. Apr 2004; 89(4): 1897-1903.
  • Fukuda T, et al. Urocortin 1, urocortin 3/stresscopin, and corticotropin-releasing factor receptors in human adrenal and its disorders. J Clin Endocrinol Metab. Aug 2005; 90(8): 4671-4678.
Full Name
Stresscopin, human
Sequence
(one-letter code)		 TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2
Sequence
(three-letter code)		{THR}{LYS}{PHE}{THR}{LEU}{SER}{LEU}{ASP}{VAL}{PRO}
{THR}{ASN}{ILE}{MET}{ASN}{LEU}{LEU}{PHE}{ASN}{ILE}
{ALA}{LYS}{ALA}{LYS}{ASN}{LEU}{ARG}{ALA}{GLN}{ALA}
{ALA}{ALA}{ASN}{ALA}{HIS}{LEU}{MET}{ALA}{GLN}{ILE}-NH2
C-TerminalNH2
DescriptionHuman Stresscopin (SCP) and Stresscopin Related Peptide (SRP), two selectively natural ligands for CRFR2, enable the suppression of food intake, delay gastric emptying, and decrease heat-induced edema. The genes for SCP and SRP were expressed in central and diverse peripheral tissues. Because CRFR2 is believed to be important in the regulation of the recovery phase of the stress response, SCP and SRP might be important in protecting the organism from damage incurred by prolonged or excessive exposure to stress. Unlike CRF and urocortin, SCP and SRP have minimal effects on ACTH release and the resultant elevations in glucocorticoids.
SolubilityThe peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
FormulaC195H326N56O53S2
M.W.4367.15
Purity> 95%
StorageStore the peptide at -20°C. Keep the container tightly closed.
NotesUrocortin and SRP are two neuropeptides involved in stress reaction and control of food intake.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10100peptide : Urocortin III, human0.5 mg
$ 166.25
GN017219 ORF Clone : UCN310 ug
$ 607.50
GN037271ORF Clone : UCN310 ug
$ 607.50




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.