You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  PACAP (1-27), human, ovine, rat   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
PACAP (1-27), human, ovine, rat

Cat. No. Size Price Figures
RP10334-0.5 mg
0.5 mg
$ 104.50
MSDS:  20080711033931  (PDF)

STRUCTURE:
PACAP (1-27), human, ovine, rat Structure
Zoom

References:
  • Ekblad E, et al. Role of endogenous PACAP in catecholamine secretion from the rat adrenal gland. Am. J. Physiol. Regul. Integr. Comp. Physiol. Nov 2001; 281(5): R1562-1567.
  • Ekblad E, et al. Characterization of intestinal receptors for VIP and PACAP in rat and in PAC1 receptor knockout mouse. Ann. N. Y. Acad. Sci. 2000; 921: 137-147.
RP10334-5 mg
5 mg
$ 722.00
Full Name
PACAP (1-27), human, ovine, rat
Sequence
(one-letter code)
HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Sequence
(three-letter code)
{HIS}{SER}{ASP}{GLY}{ILE}{PHE}{THR}{ASP}{SER}{TYR}
{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}
{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}-NH2
C-TerminalNH2
DescriptionPACAP (1-27) (the N-terminal fragment of PACAP-38) is a novel neuropeptides originally isolated from bovine hypothalamus, also found in humans and rats. PACAP (1-27) shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), and can stimulate adenylate cyclase much more potently than VIP. The PACAP(1-27)-induced increase in pancreatic venous blood flow was blocked by PACAP(6-27) but not by atropine. Therefore, the endocrine secretagogue effect of PACAP(1-27) is primarily mediated by the PAC(1) receptor, and that PACAP(1-27) may interact with muscarinic receptor function in PACAP-induced insulin and glucagon secretion in the canine pancreas in vivo.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC142H224N40O39S1
M.W.3147.62
Cas127317-03-7
Purity> 95%
StorageStore at -20°C.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10335peptide : PACAP (1-38), human, ovine, rat0.5 mg
$ 142.50
5 mg
$ 950.00
RP10337 peptide : PACAP (6-27), human, ovine, rat0.5 mg
$ 80.75
RP10338peptide : PACAP (6-38), human, ovine, rat0.5 mg
$ 133.00
5 mg
$ 950.00
RP10339 peptide : PACAP 38, frog0.5 mg
$ 161.50
5 mg
$ 1026.00
RP10341peptide : PACAP-Related Peptide (PRP), human0.5 mg
$ 137.75
RP10342 peptide : PACAP-Related Peptide (PRP), rat0.5 mg
$ 118.75




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.