| |
PACAP (1-27), human, ovine, rat  |
|
|

| Cat. No. |
Size |
Price |
Figures |
RP10334-0.5 mg
| 0.5 mg | $ 104.50 | MSDS: 20080711033931 (PDF) STRUCTURE:
 Zoom
References:
- Ekblad E, et al. Role of endogenous PACAP in catecholamine secretion from the rat adrenal gland. Am. J. Physiol. Regul. Integr. Comp. Physiol. Nov 2001; 281(5): R1562-1567.
- Ekblad E, et al. Characterization of intestinal receptors for VIP and PACAP in rat and in PAC1 receptor knockout mouse. Ann. N. Y. Acad. Sci. 2000; 921: 137-147.
|
|---|
RP10334-5 mg
| 5 mg | $ 722.00 |
|---|
| Full Name | | PACAP (1-27), human, ovine, rat |
|
Sequence (one-letter code) |
HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 | Sequence (three-letter code) | {HIS}{SER}{ASP}{GLY}{ILE}{PHE}{THR}{ASP}{SER}{TYR} {SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS} {LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}-NH2 | | C-Terminal | NH2 |
|---|
| Description | PACAP (1-27) (the N-terminal fragment of PACAP-38) is a novel neuropeptides originally isolated from bovine hypothalamus, also found in humans and rats. PACAP (1-27) shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), and can stimulate adenylate cyclase much more potently than VIP. The PACAP(1-27)-induced increase in pancreatic venous blood flow was blocked by PACAP(6-27) but not by atropine. Therefore, the endocrine secretagogue effect of PACAP(1-27) is primarily mediated by the PAC(1) receptor, and that PACAP(1-27) may interact with muscarinic receptor function in PACAP-induced insulin and glucagon secretion in the canine pancreas in vivo. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
|---|
| Formula | C142H224N40O39S1 | | M.W. | 3147.62 | | Cas | 127317-03-7 |
|---|
| Purity | > 95% | | Storage | Store at -20°C. |
| * For Non-Clinical Research Use Only *
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|