GenScript Catalog Peptide: PACAP (1-27), human, ovine, rat (RP10334)

Ekblad E, et al. Role of endogenous PACAP in catecholamine secretion from the rat adrenal gland. Am. J. Physiol. Regul. Integr. Comp. Physiol. Nov 2001; 281(5): R1562-1567.
Ekblad E, et al. Characterization of intestinal receptors for VIP and PACAP in rat and in PAC1 receptor knockout mouse. Ann. N. Y. Acad. Sci. 2000; 921: 137-147.

RP10334-5 mg

5 mg

$ 722.00

Full Name

PACAP (1-27), human, ovine, rat

Sequence
(one-letter code)

HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂

Sequence
(three-letter code)

{HIS}{SER}{ASP}{GLY}{ILE}{PHE}{THR}{ASP}{SER}{TYR}
{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}
{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}-NH₂

C-Terminal

NH₂

Description

PACAP (1-27) (the N-terminal fragment of PACAP-38) is a novel neuropeptides originally isolated from bovine hypothalamus, also found in humans and rats. PACAP (1-27) shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), and can stimulate adenylate cyclase much more potently than VIP. The PACAP(1-27)-induced increase in pancreatic venous blood flow was blocked by PACAP(6-27) but not by atropine. Therefore, the endocrine secretagogue effect of PACAP(1-27) is primarily mediated by the PAC(1) receptor, and that PACAP(1-27) may interact with muscarinic receptor function in PACAP-induced insulin and glucagon secretion in the canine pancreas in vivo.

Solubility

Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Formula

C₁₄₂H₂₂₄N₄₀O₃₉S₁

M.W.

3147.62

Cas

127317-03-7

Purity

> 95%

Storage

Store at -20�C.

* For Non-Clinical Research Use Only *

Precast Gels

Code	Name	Size	Price
RP10335	peptide : PACAP (1-38), human, ovine, rat	0.5 mg	$ 142.00
RP10335	peptide : PACAP (1-38), human, ovine, rat	5 mg	$ 950.00
RP10337	peptide : PACAP (6-27), human, ovine, rat	0.5 mg	$ 81.00
RP10338	peptide : PACAP (6-38), human, ovine, rat	0.5 mg	$ 133.00
RP10338	peptide : PACAP (6-38), human, ovine, rat	5 mg	$ 950.00
RP10339	peptide : PACAP 38, frog	0.5 mg	$ 162.00
RP10339	peptide : PACAP 38, frog	5 mg	$ 1026.00
RP10341	peptide : PACAP-Related Peptide (PRP), human	0.5 mg	$ 138.00
RP10342	peptide : PACAP-Related Peptide (PRP), rat	0.5 mg	$ 119.00


1	Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2	Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptide^TM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3	Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (²H, ¹⁵N, and ¹³C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4	Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.