| |
PACAP (1-38), human, ovine, rat  |
|
|

| Cat. No. |
Size |
Price |
Figures |
RP10335-0.5 mg
| 0.5 mg | $ 142.00 | MSDS: 20080713212741 (PDF)
References:
- Yaka R, et al. Pituitary adenylate cyclase-activating polypeptide (PACAP(1-38)) enhances N-methyl-D-aspartate receptor function and brain-derived neurotrophic factor expression via RACK1. J. Biol. Chem. Mar 2003; 278(11): 9630-9638.
- Tornoe K, et al. PACAP 1-38 as neurotransmitter in the porcine antrum. Regul. Pept. Sep 2001; 101(1-3): 109-121.
- Tornoe K, et al. PACAP-(1-38) as neurotransmitter in the porcine adrenal glands. Am. J. Physiol. Endocrinol. Metab. Dec 2000; 279(6): E1413-1425.
|
|---|
RP10335-5 mg
| 5 mg | $ 950.00 |
|---|
| Full Name | | PACAP (1-38), human, ovine, rat |
|
Sequence (one-letter code) |
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 | Sequence (three-letter code) | {HIS}{SER}{ASP}{GLY}{ILE}{PHE}{THR}{ASP}{SER}{TYR} {SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS} {LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}{GLY}{LYS}{ARG} {TYR}{LYS}{GLN}{ARG}{VAL}{LYS}{ASN}{LYS}-NH2 | | C-Terminal | NH2 |
|---|
| Description | PACAP (1-38), a novel neuropeptide isolated from the bovine hypothalamus is more active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50=7 nM). PACAP 1-38 (10-9 M) increased substance P (SP), gastrin releasing peptide (GRP), and VIP release. PACAP 1-38 (10-8 M) inhibited gastrin secretion and stimulated somatostatin secretion and motility dose-dependently. |
|---|
| Solubility | The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
|---|
| Formula | C203H331N63O53S1 | | M.W. | 4534.26 | | Cas | 137061-48-4 |
|---|
| Purity | > 95% | | Storage | Store the peptide at -20°C. | | Notes | PACAP stimulates adenylate cyclase in rat anterior pituitary cells. |
| * For Non-Clinical Research Use Only *
 |
1 |
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
|
2 |
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
|
3 |
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
|
4 |
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.
|
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|