You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  PACAP (1-38), human, ovine, rat   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
PACAP (1-38), human, ovine, rat

Cat. No. Size Price Figures
RP10335-0.5 mg
0.5 mg
$ 142.50
MSDS:  20080713212741  (PDF)


References:
  • Yaka R, et al. Pituitary adenylate cyclase-activating polypeptide (PACAP(1-38)) enhances N-methyl-D-aspartate receptor function and brain-derived neurotrophic factor expression via RACK1. J. Biol. Chem. Mar 2003; 278(11): 9630-9638.
  • Tornoe K, et al. PACAP 1-38 as neurotransmitter in the porcine antrum. Regul. Pept. Sep 2001; 101(1-3): 109-121.
  • Tornoe K, et al. PACAP-(1-38) as neurotransmitter in the porcine adrenal glands. Am. J. Physiol. Endocrinol. Metab. Dec 2000; 279(6): E1413-1425.
RP10335-5 mg
5 mg
$ 950.00
Full Name
PACAP (1-38), human, ovine, rat
Sequence
(one-letter code)
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Sequence
(three-letter code)
{HIS}{SER}{ASP}{GLY}{ILE}{PHE}{THR}{ASP}{SER}{TYR}
{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}
{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}{GLY}{LYS}{ARG}
{TYR}{LYS}{GLN}{ARG}{VAL}{LYS}{ASN}{LYS}-NH2
C-TerminalNH2
DescriptionPACAP (1-38), a novel neuropeptide isolated from the bovine hypothalamus is more active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50=7 nM). PACAP 1-38 (10-9 M) increased substance P (SP), gastrin releasing peptide (GRP), and VIP release. PACAP 1-38 (10-8 M) inhibited gastrin secretion and stimulated somatostatin secretion and motility dose-dependently.
SolubilityThe peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
FormulaC203H331N63O53S1
M.W.4534.26
Cas137061-48-4
Purity> 95%
StorageStore the peptide at -20°C.
NotesPACAP stimulates adenylate cyclase in rat anterior pituitary cells.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10334peptide : PACAP (1-27), human, ovine, rat0.5 mg
$ 104.50
5 mg
$ 722.00
RP10337 peptide : PACAP (6-27), human, ovine, rat0.5 mg
$ 80.75
RP10338peptide : PACAP (6-38), human, ovine, rat0.5 mg
$ 133.00
5 mg
$ 950.00
RP10339 peptide : PACAP 38, frog0.5 mg
$ 161.50
5 mg
$ 1026.00
RP10341peptide : PACAP-Related Peptide (PRP), human0.5 mg
$ 137.75
RP10342 peptide : PACAP-Related Peptide (PRP), rat0.5 mg
$ 118.75




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.