| |
PACAP (6-38), human, ovine, rat  |
|
|

| Cat. No. |
Size |
Price |
Figures |
RP10338-0.5 mg
| 0.5 mg | $ 133.00 | HPLC: 20060721145615 (PDF) MS: 20060721145555 (PDF) DATASHEET: 20080130215549 (DOC)
References:
- Lenard L Jr, et al. Inhibitory effect of PACAP(6-38) on relaxations induced by PACAP, VIP and non-adrenergic, non-cholinergic nerve stimulation in the guinea-pig taenia caeci. Naunyn Schmiedebergs Arch. Pharmacol. May 2000; 361(5): 492-497.
- Filipsson K, et al. PACAP contributes to insulin secretion after gastric glucose gavage in mice. Am. J. Physiol. Regul. Integr. Comp. Physiol. Aug 2000; 279(2): R424-432.
-
|
|---|
RP10338-5 mg
| 5 mg | $ 950.00 |
|---|
| Full Name | | PACAP (6-38), human, ovine, rat |
|
Sequence (one-letter code) |
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 | Sequence (three-letter code) | {PHE}{THR}{ASP}{SER}{TYR}{SER}{ARG}{TYR}{ARG}{LYS} {GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ALA}{ALA} {VAL}{LEU}{GLY}{LYS}{ARG}{TYR}{LYS}{GLN}{ARG}{VAL} {LYS}{ASN}{LYS}-NH2 | | C-Terminal | NH2 |
|---|
| Description | PACAP (6-38) is a potent antagonist of PACAP 38. PACAP (6-38) is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27-stimulated pituitary adenylate cyclase. Ki values for the inhibition of the enzyme were 7nM and 150 nM, respectively. PACAP (6-38) caused a small but significant (approximately 20%) inhibition of the NANC relaxation due to electrical field stimulation (1 Hz or 10 Hz for 20 s). At these frequencies PACAP (6-38) caused no inhibition of the NANC relaxation in the presence of the P2 purinoceptor antagonist pyridoxal-phosphate-6-azophenyl-2',4'-disulphonic acid (or PPADS) plus the NO-synthase blocker NG-nitro-L-arginine; in preparations pretreated with L-NOARG alone, PACAP (6-38) retained its inhibitory effect. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
|---|
| Formula | C182H300N56O45S1 | | M.W. | 4024.76 | | Purity | > 95% | | Storage | Store the peptide at -20°C. | | Notes | This peptide is a potent agonist. |
| * For Non-Clinical Research Use Only *
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|