GenScript Catalog Peptide: PACAP (6-38), human, ovine, rat (RP10338)

Lenard L Jr, et al. Inhibitory effect of PACAP(6-38) on relaxations induced by PACAP, VIP and non-adrenergic, non-cholinergic nerve stimulation in the guinea-pig taenia caeci. Naunyn Schmiedebergs Arch. Pharmacol. May 2000; 361(5): 492-497.
Filipsson K, et al. PACAP contributes to insulin secretion after gastric glucose gavage in mice. Am. J. Physiol. Regul. Integr. Comp. Physiol. Aug 2000; 279(2): R424-432.

RP10338-5 mg

5 mg

$ 950.00

Full Name

PACAP (6-38), human, ovine, rat

Sequence
(one-letter code)

FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂

Sequence
(three-letter code)

{PHE}{THR}{ASP}{SER}{TYR}{SER}{ARG}{TYR}{ARG}{LYS}
{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ALA}{ALA}
{VAL}{LEU}{GLY}{LYS}{ARG}{TYR}{LYS}{GLN}{ARG}{VAL}
{LYS}{ASN}{LYS}-NH₂

C-Terminal

NH₂

Description

PACAP (6-38) is a potent antagonist of PACAP 38. PACAP (6-38) is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27-stimulated pituitary adenylate cyclase. Ki values for the inhibition of the enzyme were 7nM and 150 nM, respectively. PACAP (6-38) caused a small but significant (approximately 20%) inhibition of the NANC relaxation due to electrical field stimulation (1 Hz or 10 Hz for 20 s). At these frequencies PACAP (6-38) caused no inhibition of the NANC relaxation in the presence of the P2 purinoceptor antagonist pyridoxal-phosphate-6-azophenyl-2',4'-disulphonic acid (or PPADS) plus the NO-synthase blocker NG-nitro-L-arginine; in preparations pretreated with L-NOARG alone, PACAP (6-38) retained its inhibitory effect.

Solubility

Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.

Formula

C₁₈₂H₃₀₀N₅₆O₄₅S₁

M.W.

4024.76

Purity

> 95%

Storage

Store the peptide at -20�C.

Notes

This peptide is a potent agonist.

* For Non-Clinical Research Use Only *

Precast Gels

Code	Name	Size	Price
RP10334	peptide : PACAP (1-27), human, ovine, rat	0.5 mg	$ 104.00
RP10334	peptide : PACAP (1-27), human, ovine, rat	5 mg	$ 722.00
RP10335	peptide : PACAP (1-38), human, ovine, rat	0.5 mg	$ 142.00
RP10335	peptide : PACAP (1-38), human, ovine, rat	5 mg	$ 950.00
RP10337	peptide : PACAP (6-27), human, ovine, rat	0.5 mg	$ 81.00
RP10339	peptide : PACAP 38, frog	0.5 mg	$ 162.00
RP10339	peptide : PACAP 38, frog	5 mg	$ 1026.00
RP10341	peptide : PACAP-Related Peptide (PRP), human	0.5 mg	$ 138.00
RP10342	peptide : PACAP-Related Peptide (PRP), rat	0.5 mg	$ 119.00


1	Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2	Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptide^TM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3	Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (²H, ¹⁵N, and ¹³C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4	Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.