Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  PACAP 38, frog   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
PACAP 38, frog

Cat. No. Size Price Figures
RP10339-0.5 mg
 		0.5 mg
$ 161.50
HPLC:  20060721145615  (PDF)
MS:  20060721145555  (PDF)
MSDS:  20080713221958  (PDF)


References:
  • Arimura A, et al. Potential protective action of pituitary adenylate cyclase-activating polypeptide (PACAP38) on in vitro and in vivo models of myeloma kidney injury. Blood. Jan 2006; 107(2):661-668.
  • Kinhult J, et al. The induction of carbon monoxide-mediated airway relaxation by PACAP 38 in isolated guinea pig airways. Lung. 2001; 179(1):1-8.
RP10339-5 mg
 		5 mg
$ 1026.00
Full Name
PACAP 38, frog
Sequence
(one-letter code)		 HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK-NH2
Sequence
(three-letter code)		{HIS}{SER}{ASP}{GLY}{ILE}{PHE}{THR}{ASP}{SER}{TYR}
{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}
{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}{GLY}{LYS}{ARG}
{TYR}{LYS}{GLN}{ARG}{ILE}{LYS}{ASN}{LYS}-NH2
C-TerminalNH2
DescriptionPACAP 38 is a neuropeptide that has substantial sequence homology to vasoactive intestinal peptide (VIP). Both VIP and PACAP 38 are equipotent at the VCAP-2 receptor, while PACAP 38 is equipotent to PACAP-27 and more potent than VIP at the PAC-1 receptor. Pituitary adenylate cyclase activating polypeptide (PACAP) 38 stimulates the release of LH from superfused pituitary cells and that the hypothalamus and anterior pituitary have highly selective binding sites for the peptide.
FormulaC204H333N63O53S1
M.W.4548.4
Cas137061-48-4
Purity> 95%
StorageStore at -20°C.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10334peptide : PACAP (1-27), human, ovine, rat0.5 mg
$ 104.50
5 mg
$ 722.00
RP10335 peptide : PACAP (1-38), human, ovine, rat0.5 mg
$ 142.50
5 mg
$ 950.00
RP10337peptide : PACAP (6-27), human, ovine, rat0.5 mg
$ 80.75
RP10338 peptide : PACAP (6-38), human, ovine, rat0.5 mg
$ 133.00
5 mg
$ 950.00
RP10341peptide : PACAP-Related Peptide (PRP), human0.5 mg
$ 137.75
RP10342 peptide : PACAP-Related Peptide (PRP), rat0.5 mg
$ 118.75




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.