| |
Peptide YY (PYY) (3-36), human  |
|
|
| Cat. No. |
Size |
Price |
Figures |
|---|
RP10354-0.5 mg
| 0.5 mg | $ 114.00 | HPLC: 20060721145615 (PDF)
MS: 20060721145555 (PDF)
MSDS: 20080713225231 (PDF)
References:
- Prasanth K Chelikani, et al. Daily, intermittent intravenous infusion of peptide YY(3-36) reduces daily food intake and adiposity in rats. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2006; 290(2): R298-R305.
- Frank H Koegler, et al. Peptide YY(3–36) Inhibits Morning, but Not Evening, Food Intake and Decreases Body Weight in Rhesus Macaques. Diabetes. Nov 2005; 54(11): 3198-3204.
- Timothy H Moran, et al. Peptide YY(3–36) inhibits gastric emptying and produces acute reductions in food intake in rhesus monkeys. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2005; 288(2): R384-R388.
|
|---|
| Full Name | | Peptide YY (PYY) (3-36), human |
|
Sequence
(one-letter code) |
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 | Sequence
(three-letter code) | {ILE}{LYS}{PRO}{GLU}{ALA}{PRO}{GLY}{GLU}{ASP}{ALA}
{SER}{PRO}{GLU}{GLU}{LEU}{ASN}{ARG}{TYR}{TYR}{ALA}
{SER}{LEU}{ARG}{HIS}{TYR}{LEU}
{ASN}{LEU}{VAL}{THR}{ARG}
{GLN}{ARG}{TYR}-NH2 |
|---|
| C-Terminal | NH2 |
|---|
| Description | Peptide YY (PYY), a novel 36 amino-acid amidated hormone is a component of the complex neuroendocrine control process. This gut hormone (3-36), when infused into subjects, has been shown to reduce food intake in normal-weight and obese individuals. PYY (3-36) infusion also reduces the plasma levels of the hunger-promoting hormone ghrelin. PYY (3-36) levels have been shown to drop pre-meal and then increase post-prandially. In circulation, PYY (3-36) exists in at least two molecular forms: (1-36) and (3-36). PYY (3-36) selectively binds to Y2 receptors, and it has been found in human intestine and circulating blood. |
|---|
| Solubility | The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
|---|
| Formula | C180H279N53O54 |
|---|
| M.W. | 4049.48 |
|---|
| Cas | 126339-09-1 |
|---|
| Purity | > 95% |
|---|
| Storage | Store the peptide at -20°C. |
| * For Non-Clinical Research Use Only *
 |
1 |
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
|
2 |
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
|
3 |
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
|
4 |
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.
|
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|
