You are here:  Products » Peptides&Biochemicals » Catalog Peptides - Hot Products »  Peptide YY (PYY) (3-36), human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Peptide YY (PYY) (3-36), human

Cat. No. Size Price Figures
RP10354-0.5 mg
0.5 mg
$ 114.00
HPLC:  20060721145615  (PDF)
MS:  20060721145555  (PDF)
MSDS:  20080713225231  (PDF)
PROTOCOL:  20100407015038  (PDF)


References:
  • Prasanth K Chelikani, et al. Daily, intermittent intravenous infusion of peptide YY(3-36) reduces daily food intake and adiposity in rats. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2006; 290(2): R298-R305.
  • Frank H Koegler, et al. Peptide YY(3–36) Inhibits Morning, but Not Evening, Food Intake and Decreases Body Weight in Rhesus Macaques. Diabetes. Nov 2005; 54(11): 3198-3204.
  • Timothy H Moran, et al. Peptide YY(3–36) inhibits gastric emptying and produces acute reductions in food intake in rhesus monkeys. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2005; 288(2): R384-R388.
Full Name
Peptide YY (PYY) (3-36), human
Sequence
(one-letter code)
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Sequence
(three-letter code)
{ILE}{LYS}{PRO}{GLU}{ALA}{PRO}{GLY}{GLU}{ASP}{ALA}
{SER}{PRO}{GLU}{GLU}{LEU}{ASN}{ARG}{TYR}{TYR}{ALA}
{SER}{LEU}{ARG}{HIS}{TYR}{LEU} {ASN}{LEU}{VAL}{THR}{ARG}
{GLN}{ARG}{TYR}-NH2
C-TerminalNH2
DescriptionPeptide YY (PYY), a novel 36 amino-acid amidated hormone is a component of the complex neuroendocrine control process. This gut hormone (3-36), when infused into subjects, has been shown to reduce food intake in normal-weight and obese individuals. PYY (3-36) infusion also reduces the plasma levels of the hunger-promoting hormone ghrelin. PYY (3-36) levels have been shown to drop pre-meal and then increase post-prandially. In circulation, PYY (3-36) exists in at least two molecular forms: (1-36) and (3-36). PYY (3-36) selectively binds to Y2 receptors, and it has been found in human intestine and circulating blood.
SolubilityThe peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
FormulaC180H279N53O54
M.W.4049.48
Cas126339-09-1
Purity> 95%
StorageStore the peptide at -20°C.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10355peptide : Peptide YY (PYY), human1 mg
$ 200.00
RP10356 peptide : Peptide YY (PYY), porcine0.5 mg
$ 119.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.