Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Peptide YY (PYY), human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Peptide YY (PYY), human

Cat. No. Size Price Figures
RP10355-1 mg
 		1 mg
$ 200.00
HPLC:  20050919140132  (PDF)
MASS SPECE:  20050919140154  (PDF)
MSDS:  20080627013355  (PDF)
MS:  20100304212456  (PDF)
HPLC:  20100304212441  (PDF)


References:
  • Ahituv N, et al. A PYY Q62P variant linked to human obesity. Hum Mol Genet. Feb 1 2006;15(3):387-391.
  • le Roux CW, et al. Attenuated peptide YY release in obese subjects is associated with reduced satiety. Endocrinology. Jan 2006;147(1):3-8.
  • Kim BJ, et al. Peptide YY is secreted after oral glucose administration in a gender-specific manner. J Clin Endocrinol Metab. Dec 2005;90(12):6665-6671.
Full Name
Peptide YY (PYY), human
Alias PYY
Sequence
(one-letter code)		 YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Sequence
(three-letter code)		{TYR}{PRO}{ILE}{LYS}{PRO}{GLU}{ALA}{PRO}{GLY}{GLU}
{ASP}{ALA}{SER}{PRO}{GLU}{GLU}{LEU}{ASN}{ARG}{TYR}
{TYR}{ALA}{SER}{LEU}{ARG}{HIS}{TYR}{LEU}{ASN}{LEU}
{VAL}{THR}{ARG}{GLN}{ARG}{TYR}-NH2
C-TerminalNH2
DescriptionPeptide YY (PYY) is mainly found in gastrointestinal tract. It is believed to involve feeding behavior. It is a gut hormone that inhibits both secretin- and cholecystokinin-stimulated pancreatic secretion. This peptide is an endogenous nonselective agonist at NPY receptors.
FormulaC194H295N55O57
M.W.4309.75
Cas118997-30-1
Purity> 95%
StorageStore the peptide at -20°C. Keep container tightly closed.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10354peptide : Peptide YY (PYY) (3-36), human0.5 mg
$ 114.00
RP10356 peptide : Peptide YY (PYY), porcine0.5 mg
$ 119.00




1
 Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
 Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
 Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
 Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.