Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Peptide YY (PYY), porcine   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Peptide YY (PYY), porcine

Cat. No. Size Price Figures
RP10356-0.5 mg
 		0.5 mg
$ 118.75
MSDS:  20080629213618  (PDF)


References:
  • Pinilla L, et al. Stimulatory effect of PYY-(3-36) on gonadotropin secretion is potentiated in fasted rats. Am. J. Physiol. Endocrinol. Metab. Jun 2006; 290(6): E1162-1171.
  • Lerch M, et al. Structural similarities of micelle-bound peptide YY (PYY) and neuropeptide Y (NPY) are related to their affinity profiles at the Y receptors. J Mol Biol. Jun 18 2004; 339(5): 1153-1168.
  • Ono S, et al. Application of the trimethylsilyl trifluoromethanesulfonate deprotecting procedure for the synthesis of porcine peptide YY (PYY). Int. J. Pept. protein Res. Jan 1989; 33(1): 29-38.
Full Name
Peptide YY (PYY), porcine
Alias peptide yy
Sequence
(one-letter code)		 YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
Sequence
(three-letter code)		{TYR}{PRO}{ALA}{LYS}{PRO}{GLU}{ALA}{PRO}{GLY}{GLU}
{ASP}{ALA}{SER}{PRO}{GLU}{GLU}{LEU}{SER}{ARG}{TYR}
{TYR}{ALA}{SER}{LEU}{ARG}{HIS}{TYR}{LEU}{ASN}{LEU}
{VAL}{THR}{ARG}{GLN}{ARG}{TYR}-NH2
C-TerminalNH2
DescriptionGut hormone that inhibits both secretin and cholecystokinin-stimulated pancreatic secretion. Endogenous nonselective agonist at NPY receptors.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC190H288N54O57
M.W.4240.67
Cas81858-94-8
Purity> 95%
StorageStore at -20°C. Keep tightly closed.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10354peptide : Peptide YY (PYY) (3-36), human0.5 mg
$ 114.00
RP10355 peptide : Peptide YY (PYY), human1 mg
$ 199.50




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.