| Cat. No. |
Size |
Price |
Figures |
|---|
RP10364-0.5 mg
| 0.5 mg | $ 109.25 | MSDS: 20080713225911 (PDF)
References:
- Yakar S, et al. The ternary IGF complex influences postnatal bone acquisition and the skeletal response to intermittent parathyroid hormone. J. Endocrinol. May 2006; 189(2): 289-299.
- Wang Y, et al. Gender differences in the response of CD-1 mouse bone to parathyroid hormone: potential role of IGF-I. J. Endocrinol. May 2006; 189(2): 279-287.
|
|---|
| Full Name | | Parathyroid Hormone (PTH) (1-34), bovine |
|
Sequence
(one-letter code) |
AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF |
Sequence
(three-letter code) | {ALA}{VAL}{SER}{GLU}{ILE}{GLN}{PHE}{MET}{HIS}{ASN}
{LEU}{GLY}{LYS}{HIS}{LEU}{SER}{SER}{MET}{GLU}{ARG}
{VAL}{GLU}{TRP}{LEU}{ARG}{LYS}{LYS}{LEU}{GLN}{ASP}
{VAL}{HIS}{ASN}{PHE} |
|---|
| Description | Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Parathyroid hormone is secreted as a linear protein of 84 amino acids. Parathyroid hormone accomplishes its job by stimulating at least three processes: Mobilization of calcium from bone, Enhancing absorption of calcium from the small intestine, Suppression of calcium loss in urine. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
|---|
| Formula | C183H288N54O50S2 |
|---|
| M.W. | 4108.73 |
|---|
| Purity | > 95% |
|---|
| Storage | Store ai -20°C. Keep tightly colsed. Store in a cool dry place. |
