Peptides&Biochemicals
You are here:  Products » Peptides&Biochemicals » Catalog Peptides - Hot Products »  Parathyroid Hormone (PTH) (1-34), bovine   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Parathyroid Hormone (PTH) (1-34), bovine

Cat. No. Size Price Figures
RP10364-0.5 mg
 		0.5 mg
$ 109.00
MSDS:  20080713225911  (PDF)
HPLC:  20090723070547  (PDF)
MS:  20090723070621  (PDF)
PROTOCOL:  20100407015038  (PDF)


References:
  • Yakar S, et al. The ternary IGF complex influences postnatal bone acquisition and the skeletal response to intermittent parathyroid hormone. J. Endocrinol. May 2006; 189(2): 289-299.
  • Wang Y, et al. Gender differences in the response of CD-1 mouse bone to parathyroid hormone: potential role of IGF-I. J. Endocrinol. May 2006; 189(2): 279-287.
Full Name
Parathyroid Hormone (PTH) (1-34), bovine
Sequence
(one-letter code)		 AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF
Sequence
(three-letter code)		{ALA}{VAL}{SER}{GLU}{ILE}{GLN}{PHE}{MET}{HIS}{ASN}
{LEU}{GLY}{LYS}{HIS}{LEU}{SER}{SER}{MET}{GLU}{ARG}
{VAL}{GLU}{TRP}{LEU}{ARG}{LYS}{LYS}{LEU}{GLN}{ASP}
{VAL}{HIS}{ASN}{PHE}
DescriptionParathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Parathyroid hormone is secreted as a linear protein of 84 amino acids. Parathyroid hormone accomplishes its job by stimulating at least three processes: Mobilization of calcium from bone, Enhancing absorption of calcium from the small intestine, Suppression of calcium loss in urine.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC183H288N54O50S2
M.W.4108.73
Purity> 95%
StorageStore ai -20°C. Keep tightly colsed. Store in a cool dry place.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP01001peptide : Parathyroid Hormone (PTH) (1-34), Human0.5 mg
$ 80.00
Z02021 protein : Parathyroid Hormone (PTH) (1-84 PTH), human10 ug
$ 39.00
50 ug
$ 129.00
1 mg
$ 800.00
GN153802ORF Clone : PTH10 ug
$ 308.00




1
 Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
 Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
 Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
 Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.