| |
Pancreatic Polypeptide, avian  |
|
|

| Cat. No. |
Size |
Price |
Figures |
RP10397-0.5 mg
| 0.5 mg | $ 109.25 | MSDS: 20080713231257 (PDF) STRUCTURE:
 Zoom
References:
- Dubinion JH, et al. Pancreatic polypeptide-fold peptide receptors and angiotensin II-induced renal vasoconstriction. Hypertension. Mar 2006; 47(3): 545-551.
- Feinle-Bisset C, et al. Fat digestion is required for suppression of ghrelin and stimulation of peptide YY and pancreatic polypeptide secretion by intraduodenal lipid. Am. J. Physiol. Endocrinol. Metab. Dec 2005; 289(6): E948-953.
- Schmidt PT, et al. A role for pancreatic polypeptide in the regulation of gastric emptying and short-term metabolic control. J Clin Endocrinol Metab. Sep 2005; 90(9): 5241-5246.
|
|---|
| Full Name | | Pancreatic Polypeptide, avian |
|
| Alias |
PP |
Sequence (one-letter code) |
GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2 | Sequence (three-letter code) | {GLY}{PRO}{SER}{GLN}{PRO}{THR}{TYR}{PRO}{GLY}{ASP} {ASP}{ALA}{PRO}{VAL}{GLU}{ASP}{LEU}{ILE}{ARG}{PHE} {TYR}{ASP}{ASN}{LEU}{GLN}{GLN}{TYR}{LEU}{ASN}{VAL} {VAL}{THR}{ARG}{HIS}{ARG}{TYR}-NH2 | | C-Terminal | NH2 |
|---|
| Description | Pancreatic polypeptide (PP) is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas. The exact physiologic role of PP in healthy individuals has not been fully defined. It has been shown, however, that pancreatic polypeptide affects the secretion of pancreatic enzymes, water, and electrolytes. Its effect is biphasic in that PP initially enhances secretion and then inhibits secretion. PP increases gastric emptying and gut motility. Pancreatic polypeptide also relaxes the pyloric and ileocecocolic sphincters, the colon, and gallbladder. PP levels increase after ingestion of food and remain elevated from four to eight hours. Prolonged fasting, diabetes, and exercise can also increase PP levels. Serum PP levels can be elevated in as many as 50% of patients with carcinoid syndrome. Increased levels can also be found in patients with duodenal ulcers and in patients with type I diabetes. PP levels are often low in patients with pancreatic insufficiency or pancreatitis. |
|---|
| Formula | C190H283N53O58 | | M.W. | 4237.62 | | Purity | > 95% | | Storage | Store at -20°C | | Notes | Freeze within 4 hours of collection. |
| * For Non-Clinical Research Use Only *
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|