You are here:  Products » Peptides&Biochemicals » Catalog Peptides - Hot Products »  Pancreatic Polypeptide, avian   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Pancreatic Polypeptide, avian

Cat. No. Size Price Figures
RP10397-0.5 mg
0.5 mg
$ 109.00
MSDS:  20080713231257  (PDF)
PROTOCOL:  20100407015038  (PDF)

STRUCTURE:
Pancreatic Polypeptide, avian Example
Zoom

References:
  • Dubinion JH, et al. Pancreatic polypeptide-fold peptide receptors and angiotensin II-induced renal vasoconstriction. Hypertension. Mar 2006; 47(3): 545-551.
  • Feinle-Bisset C, et al. Fat digestion is required for suppression of ghrelin and stimulation of peptide YY and pancreatic polypeptide secretion by intraduodenal lipid. Am. J. Physiol. Endocrinol. Metab. Dec 2005; 289(6): E948-953.
  • Schmidt PT, et al. A role for pancreatic polypeptide in the regulation of gastric emptying and short-term metabolic control. J Clin Endocrinol Metab. Sep 2005; 90(9): 5241-5246.
Full Name
Pancreatic Polypeptide, avian
Alias PP
Sequence
(one-letter code)
GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2
Sequence
(three-letter code)
{GLY}{PRO}{SER}{GLN}{PRO}{THR}{TYR}{PRO}{GLY}{ASP}
{ASP}{ALA}{PRO}{VAL}{GLU}{ASP}{LEU}{ILE}{ARG}{PHE}
{TYR}{ASP}{ASN}{LEU}{GLN}{GLN}{TYR}{LEU}{ASN}{VAL}
{VAL}{THR}{ARG}{HIS}{ARG}{TYR}-NH2
C-TerminalNH2
DescriptionPancreatic polypeptide (PP) is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas. The exact physiologic role of PP in healthy individuals has not been fully defined. It has been shown, however, that pancreatic polypeptide affects the secretion of pancreatic enzymes, water, and electrolytes. Its effect is biphasic in that PP initially enhances secretion and then inhibits secretion. PP increases gastric emptying and gut motility. Pancreatic polypeptide also relaxes the pyloric and ileocecocolic sphincters, the colon, and gallbladder. PP levels increase after ingestion of food and remain elevated from four to eight hours. Prolonged fasting, diabetes, and exercise can also increase PP levels. Serum PP levels can be elevated in as many as 50% of patients with carcinoid syndrome. Increased levels can also be found in patients with duodenal ulcers and in patients with type I diabetes. PP levels are often low in patients with pancreatic insufficiency or pancreatitis.
FormulaC190H283N53O58
M.W.4237.62
Purity> 95%
StorageStore at -20°C
NotesFreeze within 4 hours of collection.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10398peptide : Pancreatic Polypeptide, human0.5 mg
$ 81.00
RP10399 peptide : Pancreatic Polypeptide, rat0.5 mg
$ 95.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.