Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Pancreatic Polypeptide, human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Pancreatic Polypeptide, human

Cat. No. Size Price Figures
RP10398-0.5 mg
 		0.5 mg
$ 80.75
HPLC:  20060721145615  (PDF)
MS:  20060721145555  (PDF)
MSDS:  20080713232120  (PDF)


References:
  • Feinle-Bisset C, et al. Fat digestion is required for suppression of ghrelin and stimulation of peptide YY and pancreatic polypeptide secretion by intraduodenal lipid. Am. J. Physiol. Endocrinol. Metab. Dec 2005; 289(6): E948-953.
  • Browning KN, et al. Effects of pancreatic polypeptide on pancreas-projecting rat dorsal motor nucleus of the vagus neurons. Am. J. Physiol. Gastrointest. Liver. Physiol. Aug 2005; 289(2): G209-219.
  • Acuna-Goycolea C, et al. Mechanisms of neuropeptide Y, peptide YY, and pancreatic polypeptide inhibition of identified green fluorescent protein-expressing GABA neurons in the hypothalamic neuroendocrine arcuate nucleus. J. Neurosci. Aug 2005; 25(32): 7406-7419.
Full Name
Pancreatic Polypeptide, human
Alias PP
Sequence
(one-letter code)		 APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
Sequence
(three-letter code)		{ALA}{PRO}{LEU}{GLU}{PRO}{VAL}{TYR}{PRO}{GLY}{ASP}
{ASN}{ALA}{THR}{PRO}{GLU}{GLN}{MET}{ALA}{GLN}{TYR}
{ALA}{ALA}{ASP}{LEU}{ARG}{ARG}{TYR}{ILE}{ASN}{MET}
{LEU}{THR}{ARG}{PRO}{ARG}{TYR}-NH2
C-TerminalNH2
DescriptionPancreatic Polypeptide is an agonist at Y4 neuropeptide Y receptros. Pancreatic polypeptide (PP) is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas. The exact physiologic role of PP in healthy individuals has not been fully defined. It has been shown, however, that pancreatic polypeptide affects the secretion of pancreatic enzymes, water, and electrolytes. Its effect is biphasic in that PP initially enhances secretion and then inhibits secretion. PP increases gastric emptying and gut motility. Pancreatic polypeptide also relaxes the pyloric and ileocecocolic sphincters, the colon, and gallbladder. PP levels increase after ingestion of food and remain elevated from four to eight hours.
SolubilityThe peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
FormulaC185H287N53O54S2
M.W.4181.7
Cas75976-10-2
Purity> 95%
StorageKeep container tightly closed. Store the peptide at -20°C.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10397peptide : Pancreatic Polypeptide, avian0.5 mg
$ 109.25
RP10399 peptide : Pancreatic Polypeptide, rat0.5 mg
$ 95.00




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.