| |
Pancreatic Polypeptide, human  |
|
|
| Cat. No. |
Size |
Price |
Figures |
|---|
RP10398-0.5 mg
| 0.5 mg | $ 81.00 | HPLC: 20060721145615 (PDF)
MS: 20060721145555 (PDF)
MSDS: 20080713232120 (PDF)
PROTOCOL: 20100407015038 (PDF)
References:
- Feinle-Bisset C, et al. Fat digestion is required for suppression of ghrelin and stimulation of peptide YY and pancreatic polypeptide secretion by intraduodenal lipid. Am. J. Physiol. Endocrinol. Metab. Dec 2005; 289(6): E948-953.
- Browning KN, et al. Effects of pancreatic polypeptide on pancreas-projecting rat dorsal motor nucleus of the vagus neurons. Am. J. Physiol. Gastrointest. Liver. Physiol. Aug 2005; 289(2): G209-219.
- Acuna-Goycolea C, et al. Mechanisms of neuropeptide Y, peptide YY, and pancreatic polypeptide inhibition of identified green fluorescent protein-expressing GABA neurons in the hypothalamic neuroendocrine arcuate nucleus. J. Neurosci. Aug 2005; 25(32): 7406-7419.
|
|---|
| Full Name | | Pancreatic Polypeptide, human |
|
| Alias |
PP |
Sequence
(one-letter code) |
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2 | Sequence
(three-letter code) | {ALA}{PRO}{LEU}{GLU}{PRO}{VAL}{TYR}{PRO}{GLY}{ASP}
{ASN}{ALA}{THR}{PRO}{GLU}{GLN}{MET}{ALA}{GLN}{TYR}
{ALA}{ALA}{ASP}{LEU}{ARG}{ARG}{TYR}{ILE}{ASN}{MET}
{LEU}{THR}{ARG}{PRO}{ARG}{TYR}-NH2 |
|---|
| C-Terminal | NH2 |
|---|
| Description | Pancreatic Polypeptide is an agonist at Y4 neuropeptide Y receptros. Pancreatic polypeptide (PP) is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas. The exact physiologic role of PP in healthy individuals has not been fully defined. It has been shown, however, that pancreatic polypeptide affects the secretion of pancreatic enzymes, water, and electrolytes. Its effect is biphasic in that PP initially enhances secretion and then inhibits secretion. PP increases gastric emptying and gut motility. Pancreatic polypeptide also relaxes the pyloric and ileocecocolic sphincters, the colon, and gallbladder. PP levels increase after ingestion of food and remain elevated from four to eight hours. |
|---|
| Solubility | The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
|---|
| Formula | C185H287N53O54S2 |
|---|
| M.W. | 4181.7 |
|---|
| Cas | 75976-10-2 |
|---|
| Purity | > 95% |
|---|
| Storage | Keep container tightly closed. Store the peptide at -20°C. |
| * For Non-Clinical Research Use Only *
 |
1 |
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
|
2 |
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
|
3 |
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
|
4 |
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.
|
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|
