Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Melanostatin, frog   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Melanostatin, frog

Cat. No. Size Price Figures
RP10467-0.5 mg
 		0.5 mg
$ 118.75
HPLC:  20050919140132  (PDF)
MASS SPECE:  20050919140154  (PDF)
MSDS:  20080728225133  (PDF)


References:
  • Valentijn JA, et al. Melanostatin (NPY) inhibited electrical activity in frog melanotrophs through modulation of K+, Na+ and Ca2+ currents. J. Physiol. Mar 1994; 475(2): 185-195.
  • Palomo C, et al. Development of a new family of conformationally restricted peptides as potent nucleators of beta-turns. Design, synthesis, structure, and biological evaluation of a beta-lactam peptide analogue of melanostatin. J. Am. Chem. Soc. Dec 2003 ; 125(52): 16243-16260.
  • Lebedev AA, et al. Effect of the melanostatin analogue alaptide on dopamine-dependent behavior in rats reared in isolation. Zh. Vyssh Nerv. Deiat. Im. I. P. Pavlova. Jul-Aug 2000; 50(4): 716-719.
Full Name
Melanostatin, frog
Sequence
(one-letter code)		 YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY-NH2
Sequence
(three-letter code)		{TYR}{PRO}{SER}{LYS}{PRO}{ASP}{ASN}{PRO}{GLY}{GLU}
{ASP}{ALA}{PRO}{ALA}{GLU}{ASP}{MET}{ALA}{LYS}{TYR}
{TYR}{SER}{ALA}{LEU}{ARG}{HIS}{TYR}{ILE}{ASN}{LEU}
{ILE}{THR}{ARG}{GLN}{ARG}{TYR}-NH2
C-TerminalNH2
DescriptionMelanostatin, a thirty-six amino acid peptide recently isolated from the frog brain due to its ability to inhibit alpha-melanocyte-stimulating hormone (alpha-MSH) release, is the amphibian counterpart of mammalian neuropeptide Y (NPY). The effect of synthetic melanostatin on the bioelectrical activity of cultured frog melanotrophs was studied in 124 cells by using the whole-cell patch-clamp technique.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC189H285N53O57S1
M.W.4243.69
Purity> 95%
StorageBefore using, store the peptide in the DRY form at 0 - 5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
NotesHighly potent in inhibiting a-Melanotropin in vitro.
* For Non-Clinical Research Use Only *

If you cannot find your peptides on our list, try our Express PeptideTM Service, and receive high-quality peptides in eight business days, guaranteed.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.