Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Neuropeptide K, porcine   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Neuropeptide K, porcine

Cat. No. Size Price Figures
RP10471-0.5 mg
 		0.5 mg
$ 119.00
MSDS:  20080728231626  (PDF)


References:
  • Dike A, Cowsik SM. Three-dimensional structure of neuropeptide k bound to dodecylphosphocholine micelles. Biochemistry. Mar 2006; 45(9): 2994-3004.
  • Wong BJ, et al. Neurokinin-1 receptor desensitization to consecutive microdialysis infusions of substance P in human skin. J. Physiol. Nov 2005; 568(Pt 3): 1047-1056.
Full Name
Neuropeptide K, porcine
Alias NPK
Sequence
(one-letter code)		 DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2
Sequence
(three-letter code)		{ASP}{ALA}{ASP}{SER}{SER}{ILE}{GLU}{LYS}{GLN}{VAL}
{ALA}{LEU}{LEU}{LYS}{ALA}{LEU}{TYR}{GLY}{HIS}{GLY}
{GLN}{ILE}{SER}{HIS}{LYS}{ARG}{HIS}{LYS}{THR}{ASP}
{SER}{PHE}{VAL}{GLY}{LEU}{MET}-NH2
C-TerminalNH2
DescriptionNeuropeptide K is a 36 amino acid peptide that contains the Substance K sequence at its C-terminus. It can be cleaved to release Neurokinin A. Pre-Pro-Tachykinin is the precursor for Neuropeptide K. Neuropeptide K is one of the members of the family of Tachykinins.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC175H284N52O52S1
M.W.3980.53
Purity> 95%
StorageBefore using, store the peptide in the DRY form at 0 - 5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10458peptide : γ-Neuropeptide, rabbit0.5 mg
$ 81.00
RP10488 peptide : Neuropeptide Y (13-36), human0.5 mg
$ 57.00
5 mg
$ 380.00
RP10491peptide : Neuropeptide Y (3-36), human0.5 mg
$ 81.00
RP10492 peptide : Neuropeptide Y, human0.5 mg
$ 71.00
GN016141ORF Clone : TAC110 ug
$ 488.00
GN077028 ORF Clone : Tac110 ug
$ 491.00
GN543922ORF Clone : LOC47523910 ug
$ 491.00




1
 Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
 Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
 Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
 Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.