You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Neuropeptide Y (3-36), human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Neuropeptide Y (3-36), human

Cat. No. Size Price Figures
RP10491-0.5 mg
0.5 mg
$ 80.75
HPLC:  20050919140132  (PDF)
MASS SPECE:  20050919140154  (PDF)
MSDS:  20080813223441  (PDF)


References:
  • Grandt D, et al. Neuropeptide Y 3-36 is an endogenous ligand selective for Y2 receptors. Regul. Pept. Nov 1996; 67(1): 33-37.
  • Dumont Y, et al. Evidence for the existence of an additional class of neuropeptide Y receptor sites in rat brain. J. Pharmacol. Exp. Ther. Oct 2005; 315(1): 99-108.
Full Name
Neuropeptide Y (3-36), human
Alias NPY 3-36
Sequence
(one-letter code)
SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Sequence
(three-letter code)
{SER}{LYS}{PRO}{ASP}{ASN}{PRO}{GLY}{GLU}{ASP}{ALA}
{PRO}{ALA}{GLU}{ASP}{MET}{ALA}{ARG}{TYR}{TYR}{SER}
{ALA}{LEU}{ARG}{HIS}{TYR}{ILE}{ASN}{LEU}{ILE}{THR}
{ARG}{GLN}{ARG}{TYR}-NH2
C-TerminalNH2
DescriptionNeuropeptide Y 3-36 (NPY 3-36) is an endogenous neuropeptide that selectively binds to Y2 and Y5 receptors. NPY 3-36 accounts for 35% of NPY-like immunoreactivity in the porcine brain. NPY 3-36 has about 1/1000 the affinity of NPY 1-36 for Y1-like receptors on SK-N-MC cells.
FormulaC175H269N53O54S1
M.W.4011.4
Cas150138-78-6
Purity> 95%
StorageStore at -20°C.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10458peptide : γ-Neuropeptide, rabbit0.5 mg
$ 80.75
RP10471 peptide : Neuropeptide K, porcine0.5 mg
$ 118.75
RP10488peptide : Neuropeptide Y (13-36), human0.5 mg
$ 57.00
5 mg
$ 380.00
RP10492 peptide : Neuropeptide Y, human0.5 mg
$ 71.25




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.