Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Neuropeptide Y, human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Neuropeptide Y, human

Cat. No. Size Price Figures
RP10492-0.5 mg
 		0.5 mg
$ 71.25
HPLC:  20060721145617  (PDF)
MS:  20060721145556  (PDF)
MSDS:  20080813225924  (PDF)

EXAMPLE:
Neuropeptide Y Example
Zoom

References:
  • Bromee T, et al. Neuropeptide Y-family receptors Y and Y in chicken. Cloning, pharmacological characterization, tissue distribution and conserved synteny with human chromosome region. FEBS. J. May 2006; 273(9): 2048-2063.
  • Thiriet N, et al. Neuropeptide Y protects against methamphetamine-induced neuronal apoptosis in the mouse striatum. J. Neurosci. Jun 2005; 25(22): 5273-5279.
  • Amlal H, et al. Estrogen up-regulates neuropeptide Y Y1 receptor expression in a human breast cancer cell line. Cancer Res. Apr 2006; 66(7): 3706-3714.
Full Name
Neuropeptide Y, human
Alias NPY
Sequence
(one-letter code)		 YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Sequence
(three-letter code)		{TYR}{PRO}{SER}{LYS}{PRO}{ASP}{ASN}{PRO}{GLY}{GLU}
{ASP}{ALA}{PRO}{ALA}{GLU}{ASP}{MET}{ALA}{ARG}{TYR}
{TYR}{SER}{ALA}{LEU}{ARG}{HIS}{TYR}{ILE}{ASN}{LEU}
{ILE}{THR}{ARG}{GLN}{ARG}{TYR}-NH2
C-TerminalNH2
DescriptionNeuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion.
SolubilitySolvent: 1 mg/ml CH3COOH 0.05 M clear, colorless
FormulaC189H285N55O57S1
M.W.4271.68
Cas90880-35-6
Purity> 95%
StorageStore at -20°C.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10458peptide : γ-Neuropeptide, rabbit0.5 mg
$ 80.75
RP10471 peptide : Neuropeptide K, porcine0.5 mg
$ 118.75
RP10488peptide : Neuropeptide Y (13-36), human0.5 mg
$ 57.00
5 mg
$ 380.00
RP10491 peptide : Neuropeptide Y (3-36), human0.5 mg
$ 80.75




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.