Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Helospectin I   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Helospectin I

Cat. No. Size Price Figures
RP10592-1 mg
 		1 mg
$ 223.25

References:
  • Tsueshita T, et al. Helospectin I and II evoke vasodilation in the intact peripheral microcirculation. Peptides. Jan 2004; 25(1): 65-69.
  • Ahren B. Effects of helospectin I on insulin and glucagon secretion in the mouse. Br. J. Pharmacol. Apr 1991; 102(4): 916-918.
  • Grundemar L, Hogestatt ED. Vascular effects of helodermin, helospectin I and helospectin II: a comparison with vasoactive intestinal peptide (VIP). Br. J. Pharmacol. Mar 1990; 99(3): 526-528.
Full Name
Helospectin I
Alias HelospectinI; Helospectin 1; Helospectin1
Sequence
(one-letter code)		 HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS
Sequence
(three-letter code)		{HIS}{SER}{ASP}{ALA}{THR}{PHE}{THR}{ALA}{GLU}{TYR}
{SER}{LYS}{LEU}{LEU}{ALA}{LYS}{LEU}{ALA}{LEU}{GLN}
{LYS}{TYR}{LEU}{GLU}{SER}{ILE}{LEU}{GLY}{SER}{SER}
{THR}{SER}{PRO}{ARG}{PRO}{PRO}{SER}{SER}
DescriptionThe helospectins are peptides structurally related to helodermin, vasoactive intestinal polypeptide (VIP), peptide histidine isoleucine (PHI) and secretin, which all potently stimulate glucagon secretion in the mouse. Helospectin I potently increased plasma levels of glucagon after its intravenous injection in mice. helospectin I markedly stimulates glucagon secretion in the mouse whereas the peptide has no direct action on insulin secretion. This pattern of effect of helospectin I is similar to that previously reported for helodermin, VIP, PHI and secretin in the mouse, i.e., for all peptides belonging to this superfamily of peptides.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC183H293N47O59
M.W.4095.7
Purity> 95%
StorageBefore using, store the peptide in the DRY form at 0 - 5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10593peptide : Helospectin II1 mg
$ 223.25



If you cannot find your peptides on our list, try our Express PeptideTM Service, and receive high-quality peptides in eight business days, guaranteed.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.