| Cat. No. |
Size |
Price |
Figures |
|---|
RP10593-1 mg
| 1 mg | $ 223.25 |
References:
- Tsueshita T, et al. Helospectin I and II evoke vasodilation in the intact peripheral microcirculation. Peptides. Jan 2004; 25(1): 65-69.
- Grundemar L, Hogestatt ED. Vascular effects of helodermin, helospectin I and helospectin II: a comparison with vasoactive intestinal peptide (VIP). Br. J. Pharmacol. Mar 1990; 99(3): 526-528.
|
|---|
| Full Name | |
Sequence
(one-letter code) |
HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPS |
Sequence
(three-letter code) | {HIS}{SER}{ASP}{ALA}{THR}{PHE}{THR}{ALA}{GLU}{TYR}
{SER}{LYS}{LEU}{LEU}{ALA}{LYS}{LEU}{ALA}{LEU}{GLN}
{LYS}{TYR}{LEU}{GLU}{SER}{ILE}{LEU}{GLY}{SER}{SER}
{THR}{SER}{PRO}{ARG}{PRO}{PRO}{SER} |
|---|
| Description | Helospectin I and helospectin II, peptides recently isolated from the salivary gland venom of Heloderma suspectum, were compared to vasoactive intestinal peptide (VIP) with respect to effects on systemic blood pressure and on isolated femoral arteries in the rat. Helospectin I and II relaxed phenylephrine-contracted vessels to the same extent as VIP but with a lower potency. Helospectin I and II have a similar profile of action and therefore may act on a common receptor.
|
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
|---|
| Formula | C180H288N46O57 |
|---|
| M.W. | 4008.6 |
|---|
| Purity | > 95% |
|---|
| Storage | Before using, store the peptide in the DRY form at 0 - 5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. |
