| |
[Gln 8, 9]-Helodermin  |
|
|
| Cat. No. |
Size |
Price |
Figures |
|---|
RP10633-0.5 mg
| 0.5 mg | $ 90.25 | MSDS: 20080822023929 (PDF)
References:
- Horikawa N, et al. Glibenclamide-sensitive hypotension produced by helodermin assessed in the rat. Biol. Pharm. Bull. Dec 1998; 21(12): 1290-1293.
- Tanaka Y, et al. Glibenclamide-sensitive mechanism is involved in helodermin-produced vasodilatation in rat mesenteric artery. Res. Commun. Mol. Pathol. Pharmacol. Nov 1997; 98(2): 141-156.
- Gourlet P, et al. Analogues of VIP, helodermin, and PACAP discriminate between rat and human VIP1 and VIP2 receptors. Ann. N. Y. Acad. Sci. Dec 1998; 865: 247-252.
|
|---|
| Full Name | |
| Alias |
Helodermin [Gln8,9], [Gln8,9]-Helodermin |
Sequence
(one-letter code) |
HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP-NH2 | Sequence
(three-letter code) | {HIS}{SER}{ASP}{ALA}{ILE}{PHE}{THR}{GLN}{GLN}{TYR}
{SER}{LYS}{LEU}{LEU}{ALA}{LYS}{LEU}{ALA}{LEU}{GLN}
{LYS}{TYR}{LEU}{ALA}{SER}{ILE}{LEU}{GLY}{SER}{ARG}
{THR}{SER}{PRO}{PRO}{PRO}-NH2 |
|---|
| C-Terminal | NH2 |
|---|
| Description | [Gln8, Gln9] Helodermin is a peptide that [Glu8, Glu9] of Helodermin are replaced by [Gln8, Gln9]. Some studies show that helodermin on vascular physiology has effect on anesthetized dogs using a synthetic replicate of helodermin and helodermin related peptides. Intraarterial infusion of helodermin caused a dose-dependent increase in femoral blood flow. Helodermin was 16 times less potent than VIP and 5 times more potent than PHM (human PHI). The results demonstrate the VIP-like vasodilating activity and cardiovascular effects of helodermin in anesthetized dogs. |
|---|
| Formula | C176H284N47O49 |
|---|
| M.W. | 3842.5 |
|---|
| Purity | > 95% |
|---|
| Storage | Store at -20°C. Keep tightly closed. Store in a cool dry place. | | Notes | Helodermin is a VIP-PHI-like peptide. |
|---|
| * For Non-Clinical Research Use Only *
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|
