Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Glucagon-Like Peptide (GLP) II, human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Glucagon-Like Peptide (GLP) II, human

Cat. No. Size Price Figures
RP10769-0.5 mg
 		0.5 mg
$ 90.25
MSDS:  20080715043759  (PDF)


References:
  • Chance WT, et al. The role of polyamines in glucagon-like peptide-2 prevention of TPN-induced gut hypoplasia. Peptides. Apr 2006; 27(4): 883-892.
  • Sams A, et al. Naturally occurring glucagon-like peptide-2 (GLP-2) receptors in human intestinal cell lines. Eur. J. Pharmacol. Feb 2006; 532(1-2): 18-23.
  • Stephens J, et al. Glucagon-like peptide-2 acutely increases proximal small intestinal blood flow in TPN-fed neonatal piglets. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2006; 290(2): R283-R289.
Full Name
Glucagon-Like Peptide (GLP) II, human
Alias Glucagon-Like PeptideII; Glucagon-Like Peptide 2; Glucagon-Like Peptide2; GLP II; GLPII; GLP 2; GLP2
Sequence
(one-letter code)		 HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Sequence
(three-letter code)		{HIS}{ALA}{ASP}{GLY}{SER}{PHE}{SER}{ASP}{GLU}{MET}
{ASN}{THR}{ILE}{LEU}{ASP}{ASN}{LEU}{ALA}{ALA}{ARG}
{ASP}{PHE}{ILE}{ASN}{TRP}{LEU}{ILE}{GLN}{THR}{LYS}
{ILE}{THR}{ASP}
DescriptionGlucagon-like peptide 2 (GLP-2) is a recently identified intestinal epithelium-specific growth factor that has been shown to reduce the severity of inflammatory disorders of the intestine in rodent models. Currently Glucagon-Like Peptide 2 is used as a potential therapeutic agent for the human subjects with a broad variety of intestinal diseases characterized by intestinal damage and insufficiency.
FormulaC165H254N44O55S1
M.W.3766.2
Cas223460-79-5
Purity> 95%
StorageStore the peptide at -20°C. Keep container tightly closed.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10774peptide : Glucagon-Like Peptide (GLP) II-Arg, human0.5 mg
$ 109.25
RP10775 peptide : Glucagon-Like Peptide (GLP) II, rat0.5 mg
$ 137.75
RP12738peptide : Glucagon-Like Peptide (GLP) I (7-37)0.5 mg
$ 118.75
RP10773 peptide : Glucagon-Like Peptide (GLP) I (7-36), amide, human0.5 mg
$ 90.25
GN006652ORF Clone : GCG10 ug
$ 678.75



If you cannot find your peptides on our list, try our Express PeptideTM Service, and receive high-quality peptides in eight business days, guaranteed.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.