You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Glucagon-Like Peptide (GLP) I (7-36), amide, human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Glucagon-Like Peptide (GLP) I (7-36), amide, human

Cat. No. Size Price Figures
RP10773-0.5 mg
0.5 mg
$ 90.00
MSDS:  20080728215426  (PDF)


References:
  • Creutzfeldt WO, et al. Glucagonostatic actions and reduction of fasting hyperglycemia by exogenous glucagon-like peptide I(7-36) amide in type I diabetic patients. Diabetes Care. Jun 1996; 19(6): 580-586.
  • Jia X, et al. Effects of glucose-dependent insulinotropic polypeptide and glucagon-like peptide-I-(7-36) on insulin secretion. Am. J. Physiol. Apr 1995; 268(4 Pt 1): E645-E651.
  • Richter G, et al. Characterization of glucagon-like peptide-I(7-36)amide receptors of rat lung membranes by covalent cross-linking. FEBS. Lett. Mar 1991; 280(2): 247-250.
Full Name
Glucagon-Like Peptide (GLP) I (7-36), amide, human
Alias GLP-1 (7-36), amide, human, Glucagon Like PeptideI; Glucagon Like Peptide 1; Glucagon Like Peptide1; GLP-I; GLPI; GLP-1; GLP1
Sequence
(one-letter code)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence
(three-letter code)
{HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}
{SER}{SER}{TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}
{GLU}{PHE}{ILE}{ALA}{TRP}{LEU}{VAL}{LYS}{GLY}{ARG}-NH2
C-TerminalNH2
DescriptionGlucagon-Like Peptide I (7-36) (GLP)-1 (7-36)-NH2 is a peptide found in the mucosal endocrine cells of the intestine, and plasma levels of Glucagon-Like Peptide I (7-36)-NH2 immunoreactivity show a rise after the ingestion of a fat or mixed-component meal. The effects of physiological infusion of Glucagon-Like Peptide I (7-36)-NH2 on a submaximal gastric acid secretion in healthy volunteers at a rate known to mimic the observed postprandial rise in plasma concentrations. Some results suggest a novel role for Glucagon-Like Peptide I (7-36)-NH2 as a physiological inhibitor of gastric acid secretion in humans.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
FormulaC149H226N40O45
M.W.3297.5
Cas107444-51-9
Purity> 95%
StorageStore at -20°C. Keep tightly closed. Store in a cool dry place.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10774peptide : Glucagon-Like Peptide (GLP) II-Arg, human0.5 mg
$ 109.00
RP10775 peptide : Glucagon-Like Peptide (GLP) II, rat0.5 mg
$ 138.00
RP10769peptide : Glucagon-Like Peptide (GLP) II, human0.5 mg
$ 90.00
RP12738 peptide : Glucagon-Like Peptide (GLP) I (7-37)0.5 mg
$ 119.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.