| |
Glucagon-Like Peptide (GLP) II-Arg, human  |
|
|

| Cat. No. |
Size |
Price |
Figures |
RP10774-0.5 mg
| 0.5 mg | $ 109.00 | HPLC: 20060721145619 (PDF) MS: 20060721145558 (PDF) MSDS: 20080728222522 (PDF)
References:
- Tavakkolizadeh A, et al. Effect of growth hormone on intestinal Na+/glucose cotransporter activity. JPEN.J.Parenter.Enteral.Nutr. Jan 2001; 25(1): 18-22.
- Koehler JA, et al. The HeLa cell glucagon-like peptide-2 receptor is coupled to regulation of apoptosis and ERK1/2 activation through divergent signaling pathways. Mol.Endocrinol. Feb 2005; 19(2): 459-473.
- Estall JL, et al. The glucagon-like peptide-2 receptor C terminus modulates beta-arrestin-2 association but is dispensable for ligand-induced desensitization, endocytosis, and G-protein-dependent effector activation. J.Biol.Chem. Jun 2005; 280(23): 22124-22134.
|
|---|
| Full Name | | Glucagon-Like Peptide (GLP) II-Arg, human |
|
| Alias |
GLP-2-Arg; GLP2-Arg; GLP-II-Arg; GLPII-Arg, Glucagon Like Peptide;GLP II-Arg, human |
Sequence (one-letter code) |
HADGSFSDEMNTILDNLAARDFINWLIQTKITDR | Sequence (three-letter code) | {HIS}{ALA}{ASP}{GLY}{SER}{PHE}{SER}{ASP}{GLU}{MET} {ASN}{THR}{ILE}{LEU}{ASP}{ASN}{LEU}{ALA}{ALA}{ARG} {ASP}{PHE}{ILE}{ASN}{TRP}{LEU}{ILE}{GLN}{THR}{LYS} {ILE}{THR}{ASP}{ARG} | | Description | Glucagon-like peptide 2 is a neuropeptide that inhibits food intake when injected into the lateral ventricles of the brain and may mediate satiety. It is also a growth factor that stimulates proliferation and blocks apoptosis of intestinal epithelial cells. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
|---|
| Formula | C171H266N48O56S1 | | M.W. | 3922.29 | | Cas | 99120-49-7 |
|---|
| Purity | > 95% | | Storage | Before using, store the peptide in the DRY form at 0 - 5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. |
| * For Non-Clinical Research Use Only *
 |
1 |
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
|
2 |
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
|
3 |
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
|
4 |
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.
|
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|