Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Glucagon-Like Peptide (GLP) II-Arg, human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Glucagon-Like Peptide (GLP) II-Arg, human

Cat. No. Size Price Figures
RP10774-0.5 mg
 		0.5 mg
$ 109.25
HPLC:  20060721145619  (PDF)
MS:  20060721145558  (PDF)
MSDS:  20080728222522  (PDF)


References:
  • Tavakkolizadeh A, et al. Effect of growth hormone on intestinal Na+/glucose cotransporter activity. JPEN.J.Parenter.Enteral.Nutr. Jan 2001; 25(1): 18-22.
  • Koehler JA, et al. The HeLa cell glucagon-like peptide-2 receptor is coupled to regulation of apoptosis and ERK1/2 activation through divergent signaling pathways. Mol.Endocrinol. Feb 2005; 19(2): 459-473.
  • Estall JL, et al. The glucagon-like peptide-2 receptor C terminus modulates beta-arrestin-2 association but is dispensable for ligand-induced desensitization, endocytosis, and G-protein-dependent effector activation. J.Biol.Chem. Jun 2005; 280(23): 22124-22134.
Full Name
Glucagon-Like Peptide (GLP) II-Arg, human
Alias GLP-2-Arg; GLP2-Arg; GLP-II-Arg; GLPII-Arg, Glucagon Like Peptide
Sequence
(one-letter code)		 HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Sequence
(three-letter code)		{HIS}{ALA}{ASP}{GLY}{SER}{PHE}{SER}{ASP}{GLU}{MET}
{ASN}{THR}{ILE}{LEU}{ASP}{ASN}{LEU}{ALA}{ALA}{ARG}
{ASP}{PHE}{ILE}{ASN}{TRP}{LEU}{ILE}{GLN}{THR}{LYS}
{ILE}{THR}{ASP}{ARG}
DescriptionGlucagon-like peptide 2 is a neuropeptide that inhibits food intake when injected into the lateral ventricles of the brain and may mediate satiety. It is also a growth factor that stimulates proliferation and blocks apoptosis of intestinal epithelial cells.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC171H266N48O56S1
M.W.3922.29
Cas99120-49-7
Purity> 95%
StorageBefore using, store the peptide in the DRY form at 0 - 5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10769peptide : Glucagon-Like Peptide (GLP) II, human0.5 mg
$ 90.25
RP10775 peptide : Glucagon-Like Peptide (GLP) II, rat0.5 mg
$ 137.75
RP12738peptide : Glucagon-Like Peptide (GLP) I (7-37)0.5 mg
$ 118.75
GN006652 ORF Clone : GCG10 ug
$ 678.75



If you cannot find your peptides on our list, try our Express PeptideTM Service, and receive high-quality peptides in eight business days, guaranteed.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.