Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Glucagon-Like Peptide (GLP) II, rat   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Glucagon-Like Peptide (GLP) II, rat

Cat. No. Size Price Figures
RP10775-0.5 mg
 		0.5 mg
$ 137.75
HPLC:  20050919140132  (PDF)
MASS SPECE:  20050919140153  (PDF)
MSDS:  20080728224426  (PDF)


References:
  • Lingohr MK, et al. Specific Regulation of IRS-2 Expression by Glucose in Rat Primary Pancreatic Islet beta-Cells. J.BiolChem. Jun 2006; 281(23): 15884-15892.
  • Meier JJ, et al. The glucagon-like peptide-1 metabolite GLP-1-(9-36) amide reduces postprandial glycemia independently of gastric emptying and insulin secretion in humans. Am.J.Physiol.Endocrinol.Metab. Jun 2006; 290(6): 1118-1123.
  • Zhao T, et al. Direct effects of glucagon-like Peptide-1 on myocardial contractility and glucose uptake in normal and postischemic isolated rat hearts. J.PharmacolExp.Ther. Jun 2006; 317(3): 1106-1113.
Full Name
Glucagon-Like Peptide (GLP) II, rat
Alias GLP-2; GLP2; GLP-II; GLPII
Sequence
(one-letter code)		 HADGSFSDEMNTILDNLATRDFINWLIQTKITD
Sequence
(three-letter code)		{HIS}{ALA}{ASP}{GLY}{SER}{PHE}{SER}{ASP}{GLU}{MET}
{ASN}{THR}{ILE}{LEU}{ASP}{ASN}{LEU}{ALA}{THR}{ARG}
{ASP}{PHE}{ILE}{ASN}{TRP}{LEU}{ILE}{GLN}{THR}{LYS}
{ILE}{THR}{ASP}
DescriptionGLP-2 is related in sequence to GLP-1, glucagon, GIP and other members of the glucagon peptide superfamily. Many of these peptides exhibit an alanine at position 2, rendering them ideal substrates for degradation by the enzyme DP IV. Indeed, Analysis of circulating forms of GLP-2 in rodents and humans confirms that both GLP-21-33 and GLP-23-33 are detected in the fasting and postprandial states. Consistent with the importance of DP IV for GLP-2 bioactivity and degradation, a relatively larger amount of GLP-2 is required to stimulate GLP-2-dependent endpoints in rats compared to mice, as the former exhibit comparatively greater levels of circulating DP IV activity. Accordingly, analogues of GLP-2 that are resistant to DP IV-mediated degradation are more potent than the native peptide in vivo.
FormulaC166H256N44O56S1
M.W.3796.2
Purity> 95%
StorageStore at -20°C
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10769peptide : Glucagon-Like Peptide (GLP) II, human0.5 mg
$ 90.25
RP10774 peptide : Glucagon-Like Peptide (GLP) II-Arg, human0.5 mg
$ 109.25
RP12738peptide : Glucagon-Like Peptide (GLP) I (7-37)0.5 mg
$ 118.75
GN077067 ORF Clone : Gcg10 ug
$ 678.75



If you cannot find your peptides on our list, try our Express PeptideTM Service, and receive high-quality peptides in eight business days, guaranteed.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.