| Cat. No. |
Size |
Price |
Figures |
|---|
RP10792-0.5 mg
| 0.5 mg | $ 80.75 | MSDS: 20080729032830 (PDF)
References:
- Zhang Q, et al. Phosphorylation of TNF-alpha converting enzyme by gastrin-releasing peptide induces amphiregulin release and EGF receptor activation. Proc. Natl. Acad. Sci. USA. May 2006; 103(18): 6901-6906.
- Zhou J, et al. Targeting gastrin-releasing peptide receptors on small cell lung cancer cells with a bispecific molecule that activates polyclonal T lymphocytes. Clin. Cancer Res. Apr 2006; 12(7Pt1): 2224-2231.
|
|---|
| Full Name | | Gastrin Releasing Peptide, porcine |
|
| Alias |
GRP |
Sequence
(one-letter code) |
APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2 |
Sequence
(three-letter code) | {ALA}{PRO}{VAL}{SER}{VAL}{GLY}{GLY}{GLY}{THR}{VAL}
{LEU}{ALA}{LYS}{MET}{TYR}{PRO}{ARG}{GLY}{ASN}{HIS}
{TRP}{ALA}{VAL}{GLY}{HIS}{LEU}{MET} |
|---|
| C-Terminal | NH2 |
|---|
| Description | Gastrin releasing peptide (GRP) is released by the postganglionic fibres of the vagus nerve which innervate the G cells of the stomach and stimulate them to release gastrin. GRP can directly stimulate pepsinogen release from chief cells by a specific GRP receptor that mobilizes intracellular calcium. Gastrin-releasing peptide has a prominent role as a tumour marker in the diagnosis of small-cell lung carcinoma. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
|---|
| Formula | C126H198N38O31S2 |
|---|
| M.W. | 2805.4 |
|---|
| Cas | 74815-57-9 |
|---|
| Purity | > 95% |
|---|
| Storage | Store at -20°C. Keep tightly closed. Store at a cool dry place. |
