GenScript Catalog Peptide: Gastrin Releasing Peptide, porcine (RP10792)

Zhang Q, et al. Phosphorylation of TNF-alpha converting enzyme by gastrin-releasing peptide induces amphiregulin release and EGF receptor activation. Proc. Natl. Acad. Sci. USA. May 2006; 103(18): 6901-6906.
Zhou J, et al. Targeting gastrin-releasing peptide receptors on small cell lung cancer cells with a bispecific molecule that activates polyclonal T lymphocytes. Clin. Cancer Res. Apr 2006; 12(7Pt1): 2224-2231.

Full Name

Gastrin Releasing Peptide, porcine

Alias

GRP

Sequence
(one-letter code)

APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2

Sequence
(three-letter code)

{ALA}{PRO}{VAL}{SER}{VAL}{GLY}{GLY}{GLY}{THR}{VAL}
{LEU}{ALA}{LYS}{MET}{TYR}{PRO}{ARG}{GLY}{ASN}{HIS}
{TRP}{ALA}{VAL}{GLY}{HIS}{LEU}{MET}

C-Terminal

NH₂

Description

Gastrin releasing peptide (GRP) is released by the postganglionic fibres of the vagus nerve which innervate the G cells of the stomach and stimulate them to release gastrin. GRP can directly stimulate pepsinogen release from chief cells by a specific GRP receptor that mobilizes intracellular calcium. Gastrin-releasing peptide has a prominent role as a tumour marker in the diagnosis of small-cell lung carcinoma.

Solubility

Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Formula

C₁₂₆H₁₉₈N₃₈O₃₁S₂

M.W.

2805.4

Cas

74815-57-9

Purity

> 95%

Storage

Store at -20�C. Keep tightly closed. Store at a cool dry place.

* For Non-Clinical Research Use Only *

Precast Gels

Code	Name	Size	Price
RP12742	peptide : Gastrin-1, rat	0.5 mg	$ 57.00
RP10793	peptide : Gastrin, chicken	0.5 mg	$ 157.00
RP12740	peptide : Gastrin-1, human	0.5 mg	$ 57.00
RP10791	peptide : Gastrin-Releasing Peptide, human	0.5 mg	$ 90.00
RP10781	peptide : Ghrelin, rat	1 mg	$ 190.00
RP10781	peptide : Ghrelin, rat	5 mg	$ 760.00


1	Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2	Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptide^TM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3	Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (²H, ¹⁵N, and ¹³C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4	Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.