A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Gastrin, chicken

Cat. No. Size Price Figures
RP10793-0.5 mg
0.5 mg
$ 157.00
MSDS:  20080730015055  (PDF)

EXAMPLE:
Gastrin, chicken Example
Zoom

References:
  • Chang AJ, et al. Attenuation of peroxisome proliferator-activated receptor gamma (PPARgamma) mediates gastrin-stimulated colorectal cancer cell proliferation. J. Biol. Chem. May 2006; 281(21): 14700-14710
  • Fukui T, et al. Gastric mucosal hyperplasia via upregulation of gastrin induced by persistent activation of gastric innate immunity in major histocompatibility complex class II deficient mice. Gut. May 2006; 55(5): 607-615.
Full Name
Gastrin, chicken
Sequence
(one-letter code)
FLPHVFAELSDRKGFVQGNGAVEALHDFYPDWMDF
Sequence
(three-letter code)
{PHE}{LEU}{PRO}{HIS}{VAL}{PHE}{ALA}{GLU}{LEU}{SER}
{ASP}{ARG}{LYS}{GLY}{PHE}{VAL}{GLN}{GLY}{ASN}{GLY}
{ALA}{VAL}{GLU}{ALA}{LEU}{HIS}{ASP}{PHE}{TYR}{PRO}
{ASP}{TRP}{MET}{ASP}{PHE}
C-TerminalNH2
DescriptionGastrin is a major physiological regulator of gastric acid secretion. It also has an important trophic or growth-promoting influence on the gastric mucosa. Gastrin is synthesized in G cells, which are located in gastric pits, primarily in the antrum region of the stomach and binds receptors found predominantly on parietal and enterochromaffin-like cells. Gastrin appears to have at least two major effects on gastrointestinal function: Stimulation of gastric acid secretion and promotion of gastric mucosal growth.
FormulaC190H265N47O51S1
M.W.4055.6
Purity> 95%
StorageStore at -20°C. Keep tightly closed. Store in a cool dry place.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10792peptide : Gastrin Releasing Peptide, porcine0.5 mg
$ 81.00
RP10793 peptide : Gastrin, chicken0.5 mg
$ 157.00
RP12742peptide : Gastrin-1, rat0.5 mg
$ 57.00
RP10791 peptide : Gastrin-Releasing Peptide, human0.5 mg
$ 90.00
RP10781peptide : Ghrelin, rat1 mg
$ 190.00
5 mg
$ 760.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.