| |
| Gastric Inhibitory Peptide (GIP), human |
|
|
| Cat. No. |
Size |
Price |
Figures |
|---|
RP10795-0.5 mg
| 0.5 mg | $ 90.25 | HPLC: 20080901050128 (PDF)
MS: 20080901050159 (PDF)
MSDS: 20080730020551 (PDF)
References:
- Wachters-Hagedoorn RE, et al. The rate of intestinal glucose absorption is correlated with plasma glucose-dependent insulinotropic polypeptide concentrations in healthy men. J Nutr. Jun 2006; 136(6): 1511-1516.
- Simmons DP, et al. Evidence that sequence homologous region in LRAT-like proteins possesses anti-proliferative activity and DNA binding properties: translational implications and mechanism of action. Carcinogenesis. Apr 2006; 27(4): 693-707.
- Kim MJ, et al. Exendin-4 induction of cyclin D1 expression in INS-1 beta-cells: involvement of cAMP-responsive element. J Endocrinol. Mar 2006; 188(3): 623-633.
|
|---|
| Full Name | | Gastric Inhibitory Peptide (GIP), human |
|
Sequence
(one-letter code) |
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ | Sequence
(three-letter code) | {TYR}{ALA}{GLU}{GLY}{THR}{PHE}{ILE}{SER}{ASP}{TYR}
{SER}{ILE}{ALA}{MET}{ASP}{LYS}{ILE}{HIS}{GLN}{GLN}
{ASP}{PHE}{VAL}{ASN}{TRP}{LEU}{LEU}{ALA}{GLN}{LYS}
{GLY}{LYS}{LYS}{ASN}{ASP}{TRP}{LYS}{HIS}{ASN}{ILE}
{THR}{GLN} |
|---|
| Description | GIP, also known as gastric inhibitory polypeptide, or glucose-dependent insulinotropic polypeptide, is a 42-amino-acid peptide hormone synthesized in and secreted from K cells in the intestinal epithelium. There are two major GIP molecular forms in circulation, GIP (1-42) and GIP(3-42). Previous studies have demonstrated that GIP (3-42) is a degraded form of GIP (1-42) by the enzyme DPPIV. GIP secretion is primarily regulated by nutrients, especially fat. GIP exhibits potent incretin activity in rodent and human subjects. The primary action of GIP is the stimulation of glucose-dependent insulin secretion. GIP may also play a role in adipocyte biology. |
|---|
| Solubility | The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
|---|
| Formula | C226H338N60O66S1 |
|---|
| M.W. | 4983.6 |
|---|
| Cas | 100040-31-1 |
|---|
| Purity | > 95% |
|---|
| Storage | Store the peptide at -20°C.
|
| * For Non-Clinical Research Use Only * If you cannot find your peptides on our list, try our Express PeptideTM Service, and receive high-quality peptides in eight business days, guaranteed. Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance. |
|
