You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Gastric Inhibitory Peptide (GIP), human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Gastric Inhibitory Peptide (GIP), human

Cat. No. Size Price Figures
RP10795-0.5 mg
0.5 mg
$ 90.00
HPLC:  20081111023743  (PDF)
MS:  20081111023828  (PDF)
MSDS:  20080730020551  (PDF)


References:
  • Wachters-Hagedoorn RE, et al. The rate of intestinal glucose absorption is correlated with plasma glucose-dependent insulinotropic polypeptide concentrations in healthy men. J Nutr. Jun 2006; 136(6): 1511-1516.
  • Simmons DP, et al. Evidence that sequence homologous region in LRAT-like proteins possesses anti-proliferative activity and DNA binding properties: translational implications and mechanism of action. Carcinogenesis. Apr 2006; 27(4): 693-707.
  • Kim MJ, et al. Exendin-4 induction of cyclin D1 expression in INS-1 beta-cells: involvement of cAMP-responsive element. J Endocrinol. Mar 2006; 188(3): 623-633.
Full Name
Gastric Inhibitory Peptide (GIP), human
Sequence
(one-letter code)
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Sequence
(three-letter code)
{TYR}{ALA}{GLU}{GLY}{THR}{PHE}{ILE}{SER}{ASP}{TYR}
{SER}{ILE}{ALA}{MET}{ASP}{LYS}{ILE}{HIS}{GLN}{GLN}
{ASP}{PHE}{VAL}{ASN}{TRP}{LEU}{LEU}{ALA}{GLN}{LYS}
{GLY}{LYS}{LYS}{ASN}{ASP}{TRP}{LYS}{HIS}{ASN}{ILE}
{THR}{GLN}
DescriptionGIP, also known as gastric inhibitory polypeptide, or glucose-dependent insulinotropic polypeptide, is a 42-amino-acid peptide hormone synthesized in and secreted from K cells in the intestinal epithelium. There are two major GIP molecular forms in circulation, GIP (1-42) and GIP(3-42). Previous studies have demonstrated that GIP (3-42) is a degraded form of GIP (1-42) by the enzyme DPPIV. GIP secretion is primarily regulated by nutrients, especially fat. GIP exhibits potent incretin activity in rodent and human subjects. The primary action of GIP is the stimulation of glucose-dependent insulin secretion. GIP may also play a role in adipocyte biology.
SolubilityThe peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
FormulaC226H338N60O66S1
M.W.4983.6
Cas100040-31-1
Purity> 95%
StorageStore the peptide at -20°C.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
GN006733ORF Clone : GIP10 ug
$ 578.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.