Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Galanin, human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Galanin, human

Cat. No. Size Price Figures
RP10801-0.5 mg
 		0.5 mg
$ 90.25
MSDS:  20080730022613  (PDF)

EXAMPLE:
Galanin, human Example
Zoom

References:
  • Schauble N, et al. Human galanin (GAL) and galanin 1 receptor (GALR1) variations are not involved in fat intake and early onset obesity. J. Nutr. Jun 2005; 135(6): 1387-1392.
  • Merchenthaler I, et al. Estrogen and estrogen receptor-{beta} (ER{beta})-selective ligands induce galanin expression within gonadotropin hormone-releasing hormone-immunoreactive neurons in the female rat brain. Endocrinology. Jun 2005; 146(6): 2760-2765.
Full Name
Galanin, human
Sequence
(one-letter code)		 GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Sequence
(three-letter code)		{GLY}{TRP}{THR}{LEU}{ASN}{SER}{ALA}{GLY}{TYR}{LEU}
{LEU}{GLY}{PRO}{HIS}{ALA}{VAL}{GLY} {ASN}{HIS}{ARG}{SER}
{PHE}{SER}{ASP}{LYS}{ASN}{GLY}{LEU}{THR}{SER}
DescriptionGalanin is a neuropeptide that has not been established as a member of any known family of neuropeptides despite repeated efforts to discover related peptides. Its actions are mediated via Gi-protein-coupled receptors and ion channels, usually producing inhibition of secretion of a transmitter or hormone in the nervous and endocrine system. In many respects, these inhibitory actions of galanin remind us of those of gamma-aminobutyric acid (GABA) and of neuropeptide Y (NPY). Galanin coexists with GABA, noradrenaline, 5-hydroxytryptamine (5-HT), and NPY in several regions of the brain.
SolubilityThe peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
FormulaC139H210N42O43
M.W.3157.41
Cas119418-04-1
Purity> 95%
StorageStore the peptide at -20°C. Keep container tightly closed.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10802peptide : Galanin, porcine0.5 mg
$ 109.25
RP13446 peptide : Galanin, bovine0.2 mg
$ 118.75
RP13439peptide : Galanin-Like Peptide, rat0.1 mg
$ 190.00
RP13435 peptide : Galanin-Like Peptide, human0.1 mg
$ 152.00
RP10803peptide : Galanin, rat1 mg
$ 156.75
RP10804 peptide : Galantide0.5 mg
$ 71.25
GN006550ORF Clone : GAL10 ug
$ 465.00



If you cannot find your peptides on our list, try our Express PeptideTM Service, and receive high-quality peptides in eight business days, guaranteed.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.