Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Galanin, rat   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Galanin, rat

Cat. No. Size Price Figures
RP10803-1 mg
 		1 mg
$ 157.00
HPLC:  20060721145619  (PDF)
MS:  20060721145559  (PDF)
MSDS:  20080730033033  (PDF)

STRUCTURE:
Galanin, rat Structure
Zoom
STRUCTURE:
Galanin, human Example
Zoom

References:
  • O'Halloran DJ, et al. Effect of endocrine manipulation on anterior pituitary galanin in the rat. Endocrinology. Jul 1990; 127(1): 467-475.
  • Sood S, et al. Inhibition of serotonergic medullary raphe obscurus neurons suppresses genioglossus and diaphragm activities in anesthetized but not conscious rats. J.Appl.Physiol. Jun 2006; 100(6): 1807-1821.
  • Tovar S, et al. Effects of single or repeated intravenous administration of kisspeptin upon dynamic LH secretion in conscious male rats. Endocrinology. Jun 2006; 147(6): 2696-2704.
Full Name
Galanin, rat
Sequence
(one-letter code)		 GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
Sequence
(three-letter code)		{GLY}{TRP}{THR}{LEU}{ASN}{SER}{ALA}{GLY}{TYR}{LEU}
{LEU}{GLY}{PRO}{HIS}{ALA}{ILE}{ASP}{ASN}{HIS}{ARG}
{SER}{PHE}{SER}{ASP}{LYS}{HIS}{GLY}{LEU}{THR}-NH2
C-TerminalNH2
DescriptionGalanin is widely distributed throughout the rat neural and endocrine system. The highest concentrations are found in the anterior pituitary, and it can influence classical pituitary hormone secretion. The effects of endocrine manipulation on pituitary galanin content, mRNA, and immunostaining have been investigated in the rat. In females, medical (39 +/- 4 fmol/gland), surgical (33 +/- 2), or combined (28 +/- 6) castration resulted in a highly significant decrease in galanin content (control, 223 +/- 14; P less than 0.0001). Estrogen in physiological and pharmacological doses produced a significant increase in galanin content (368 +/- 14 and 373 +/- 13, respectively; P less than 0.01) associated with an increase in galanin mRNA content.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC141H211N43O41
M.W.3164.45
Cas114547-31-8
Purity> 95%
StorageStore at -20°C.
NotesAnti-Galanin (Rat) Serum ( H-026-13) can be used for Immunohistochemistry in the rat brain tissue!!!
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10801peptide : Galanin, human0.5 mg
$ 90.00
RP13446 peptide : Galanin, bovine0.2 mg
$ 119.00
RP13439peptide : Galanin-Like Peptide, rat0.1 mg
$ 190.00
RP13435 peptide : Galanin-Like Peptide, human0.1 mg
$ 152.00
RP10802peptide : Galanin, porcine0.5 mg
$ 109.00
RP10804 peptide : Galantide0.5 mg
$ 71.00




1
 Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
 Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
 Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
 Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.