| |
Galanin, rat  |
|
|

| Cat. No. |
Size |
Price |
Figures |
RP10803-1 mg
| 1 mg | $ 156.75 | HPLC: 20060721145619 (PDF) MS: 20060721145559 (PDF) MSDS: 20080730033033 (PDF) STRUCTURE:
 Zoom STRUCTURE:
 Zoom
References:
- O'Halloran DJ, et al. Effect of endocrine manipulation on anterior pituitary galanin in the rat. Endocrinology. Jul 1990; 127(1): 467-475.
- Sood S, et al. Inhibition of serotonergic medullary raphe obscurus neurons suppresses genioglossus and diaphragm activities in anesthetized but not conscious rats. J.Appl.Physiol. Jun 2006; 100(6): 1807-1821.
- Tovar S, et al. Effects of single or repeated intravenous administration of kisspeptin upon dynamic LH secretion in conscious male rats. Endocrinology. Jun 2006; 147(6): 2696-2704.
|
|---|
| Full Name | |
Sequence (one-letter code) |
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 | Sequence (three-letter code) | {GLY}{TRP}{THR}{LEU}{ASN}{SER}{ALA}{GLY}{TYR}{LEU} {LEU}{GLY}{PRO}{HIS}{ALA}{ILE}{ASP}{ASN}{HIS}{ARG} {SER}{PHE}{SER}{ASP}{LYS}{HIS}{GLY}{LEU}{THR}-NH2 | | C-Terminal | NH2 |
|---|
| Description | Galanin is widely distributed throughout the rat neural and endocrine system. The highest concentrations are found in the anterior pituitary, and it can influence classical pituitary hormone secretion. The effects of endocrine manipulation on pituitary galanin content, mRNA, and immunostaining have been investigated in the rat. In females, medical (39 +/- 4 fmol/gland), surgical (33 +/- 2), or combined (28 +/- 6) castration resulted in a highly significant decrease in galanin content (control, 223 +/- 14; P less than 0.0001). Estrogen in physiological and pharmacological doses produced a significant increase in galanin content (368 +/- 14 and 373 +/- 13, respectively; P less than 0.01) associated with an increase in galanin mRNA content. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
|---|
| Formula | C141H211N43O41 | | M.W. | 3164.45 | | Cas | 114547-31-8 |
|---|
| Purity | > 95% | | Storage | Store at -20°C. | | Notes | Anti-Galanin (Rat) Serum ( H-026-13) can be used for Immunohistochemistry in the rat brain tissue!!! |
| * For Non-Clinical Research Use Only *
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|