You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Fibronectin-Binding Protein   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Fibronectin-Binding Protein

Cat. No. Size Price Figures
RP10840-0.5 mg
0.5 mg
$ 81.00
MSDS:  20080728035855  (PDF)


References:
  • Fischer JR, et al. Fibronectin binding protein BBK32 of the Lyme disease spirochete promotes bacterial attachment to glycosaminoglycans. Infect. Immun. Jan 2006; 74(1): 435-441.
  • Towers RJ, et al. Fibronectin-binding protein gene recombination and horizontal transfer between group A and G streptococci. J. Clin. Microbiol. Nov 2004; 42(11): 5357-5361.
  • Rice K, et al. Variance in fibronectin binding and fnb locus polymorphisms in Staphylococcus aureus: identification of antigenic variation in a fibronectin binding protein adhesin of the epidemic CMRSA-1 strain of methicillin-resistant S. aureus. Infect. Immun. Jun 2001; 69(6): 3791-3799.
Full Name
Fibronectin-Binding Protein
Alias FnBP
Sequence
(one-letter code)
FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV
Sequence
(three-letter code)
{PHE}{ASN}{LYS}{HIS}{THR}{GLU}{ILE}{ILE}{GLU}{GLU}
{ASP}{THR}{ASN}{LYS}{ASP}{LYS}{PRO}{SER}{TYR}{GLN}
{PHE}{GLY}{GLY}{HIS}{ASN}{SER}{VAL}{ASP}{PHE}{GLU}
{GLU}{ASP}{THR}{LEU}{PRO}{LYS}{VAL}
DescriptionFibronectin-binding protein (Fbp) is known to be involved in bacterial adhesion to cell surface for colonization, and hence to be a virulence factor. The ability of bacteria to bind fibronectin is thought to enable the colonization of wound tissue and blood clots. The fibronectin-binding protein is directly involved in the fibronectin-mediated adherence of the bacteria to epithelial cells.
FormulaC190H283N49O66
M.W.4309.7
Cas119977-20-7
Purity> 95%
StorageStore the peptide at -20°C. Keep the container tightly closed. Store in a cool dry place.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP13450peptide : Fibronectin Fragment (Arg-Gly-Asp)0.5 mg
$ 25.00
RP10838 peptide : Fibronectin CS1 Peptide1 mg
$ 24.00
5 mg
$ 62.00
RP13449peptide : Arg-Phe-Asp-Ser0.5 mg
$ 38.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.