| Cat. No. |
Size |
Price |
Figures |
|---|
RP10840-0.5 mg
| 0.5 mg | $ 80.75 | MSDS: 20080728035855 (PDF)
References:
- Fischer JR, et al. Fibronectin binding protein BBK32 of the Lyme disease spirochete promotes bacterial attachment to glycosaminoglycans. Infect. Immun. Jan 2006; 74(1): 435-441.
- Towers RJ, et al. Fibronectin-binding protein gene recombination and horizontal transfer between group A and G streptococci. J. Clin. Microbiol. Nov 2004; 42(11): 5357-5361.
- Rice K, et al. Variance in fibronectin binding and fnb locus polymorphisms in Staphylococcus aureus: identification of antigenic variation in a fibronectin binding protein adhesin of the epidemic CMRSA-1 strain of methicillin-resistant S. aureus. Infect. Immun. Jun 2001; 69(6): 3791-3799.
|
|---|
| Full Name | | Fibronectin-Binding Protein |
|
| Alias |
FnBP |
Sequence
(one-letter code) |
FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV |
Sequence
(three-letter code) | {PHE}{ASN}{LYS}{HIS}{THR}{GLU}{ILE}{ILE}{GLU}{GLU}
{ASP}{THR}{ASN}{LYS}{ASP}{LYS}{PRO}{SER}{TYR}{GLN}
{PHE}{GLY}{GLY}{HIS}{ASN}{SER}{VAL}{ASP}{PHE}{GLU}
{GLU}{ASP}{THR}{LEU}{PRO}{LYS}{VAL} |
|---|
| Description | Fibronectin-binding protein (Fbp) is known to be involved in bacterial adhesion to cell surface for colonization, and hence to be a virulence factor. The ability of bacteria to bind fibronectin is thought to enable the colonization of wound tissue and blood clots. The fibronectin-binding protein is directly involved in the fibronectin-mediated adherence of the bacteria to epithelial cells. |
|---|
| Formula | C190H283N49O66 |
|---|
| M.W. | 4309.7 |
|---|
| Cas | 119977-20-7 |
|---|
| Purity | > 95% |
|---|
| Storage | Store the peptide at -20°C. Keep the container tightly closed. Store in a cool dry place.
|
