Peptides&Biochemicals
You are here:  Products » Peptides&Biochemicals » Catalog Peptides - Hot Products »  Exendin (9-39)   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Exendin (9-39)

Cat. No. Size Price Figures
RP10872-0.5 mg
 		0.5 mg
$ 138.00
HPLC:  20050919140132  (PDF)
MS:  20050919140154  (PDF)
MSDS:  20080923021500  (PDF)
PROTOCOL:  20100407015038  (PDF)


References:
  • Green BD, et al. Chronic treatment with exendin(9-39)amide indicates a minor role for endogenous glucagon-like peptide-1 in metabolic abnormalities of obesity-related diabetes in ob/ob mice. J. Endocrinol. May 2005; 185(2): 307-317.
  • Ayachi SE, et al. Contraction induced by glicentin on smooth muscle cells from the human colon is abolished by exendin (9-39). Neurogastroenterol. Motil. Apr 2005; 17(2): 302-309.
  • Banks WA, et al. Brain uptake of the glucagon-like peptide-1 antagonist exendin(9-39) after intranasal administration. J. Pharmacol. Exp. Ther. May 2004; 309(2): 469-475.
Full Name
Exendin (9-39)
Sequence
(one-letter code)		 DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence
(three-letter code)		{ASP}{LEU}{SER}{LYS}{GLN}{MET}{GLU}{GLU}{GLU}{ALA}
{VAL}{ARG}{LEU}{PHE}{ILE}{GLU}{TRP}{LEU}{LYS}{ASN}
{GLY}{GLY}{PRO}{SER}{SER}{GLY}{ALA}{PRO}{PRO}{PRO}
{SER}-NH2
C-TerminalNH2
DescriptionExendin (9-39) is an inverse agonist of the murine glucagon-like peptide-1 receptor. There are implications for basal intracellular cyclic adenosine 3', 5'-monophosphate levels and beta-cell glucose competence. Exendin (9-39) is a competitive inhibitor of Exendin-3 and Exendin-4. On digestive smooth muscle, exendin (9-39) behaves as an antagonist for two members of the glucagon-receptor family, GLP-1 and glicentin.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
FormulaC149H234N40O47S1
M.W.3369.76
Cas133514-43-9
Purity> 95%
StorageStore the peptide at -20°C.
NotesSpecific exendin receptor antagonist.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10873peptide : Exendin-30.5 mg
$ 147.00
RP10874 peptide : Exendin-40.5 mg
$ 147.00
100 mg
$ 3200.00




1
 Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
 Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
 Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
 Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.