Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Exendin-4   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Exendin-4

Cat. No. Size Price Figures
RP10874-0.5 mg
 		0.5 mg
$ 147.25
HPLC:  20060721145619  (PDF)
MS:  20060721145559  (PDF)
MSDS:  20080923030855  (PDF)


References:
  • Park S, et al. Exendin-4 uses Irs2 signaling to mediate pancreatic beta cell growth and function. J. Biol. Chem. Jan 2006; 281(2): 1159-1168.
  • Gardiner SM, et al. Mesenteric vasoconstriction and hindquarters vasodilatation accompany the pressor actions of exendin-4 in conscious rats. J. Pharmacol. Exp. Ther. Feb 2006; 316(2): 852-859.
  • Kim MJ, et al. Exendin-4 induction of cyclin D1 expression in INS-1 beta-cells: involvement of cAMP-responsive element. J. Endocrinol. Mar 2006; 188(3): 623-633.
RP10874-100 mg
 		100 mg
$ 3200.00
Full Name
Exendin-4
Alias Exendin4, exenatide; Byetta
Sequence
(one-letter code)		 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence
(three-letter code)		{HIS}{GLY}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{LEU}
{SER}{LYS}{GLN}{MET}{GLU}{GLU}{GLU}{ALA}{VAL}{ARG}
{LEU}{PHE}{ILE}{GLU}{TRP}{LEU}{LYS}{ASN}{GLY}{GLY}
{PRO}{SER}{SER}{GLY}{ALA}{PRO}{PRO}{PRO}{SER}-NH2
C-TerminalNH2
DescriptionExendin-4 is a 39-amino acid peptide amide. Exendin-4, like Exendin-3, stimulates an increase in acinar cAMP without stimulating the release of amylase. Exendin-4 is a long-acting potent agonist of the glucagon-like peptide 1 (GLP-1). Exendin-4 is the active component of Byetta (exenatide) injection, which may improve glycemic control in people with type 2 diabetes mellitus and has the potential to reduce plasma glucose at least partly by a delay in gastric emptying as well as by reducing calorie intake. Exendin-4 enhances glucose-dependent insulin secretion by the pancreatic β-cell and suppresses inappropriately elevated glucagon secretion.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
FormulaC184H282N50O60S
M.W.4186.66
Cas141758-74-9
Purity> 95%
StorageStore the peptide at -20°C.
NotesThis peptide interacts interacts with exendin receptor to increase pancreatic acinar cAMP. It has no secretagogue activity and does not bind to VIP receptors.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10872peptide : Exendin (9-39)0.5 mg
$ 137.75
RP10873 peptide : Exendin-30.5 mg
$ 147.25




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.