| Cat. No. |
Size |
Price |
Figures |
|---|
RP10874-0.5 mg
| 0.5 mg | $ 147.25 | HPLC: 20060721145619 (PDF)
MS: 20060721145559 (PDF)
MSDS: 20080923030855 (PDF)
References:
- Park S, et al. Exendin-4 uses Irs2 signaling to mediate pancreatic beta cell growth and function. J. Biol. Chem. Jan 2006; 281(2): 1159-1168.
- Gardiner SM, et al. Mesenteric vasoconstriction and hindquarters vasodilatation accompany the pressor actions of exendin-4 in conscious rats. J. Pharmacol. Exp. Ther. Feb 2006; 316(2): 852-859.
- Kim MJ, et al. Exendin-4 induction of cyclin D1 expression in INS-1 beta-cells: involvement of cAMP-responsive element. J. Endocrinol. Mar 2006; 188(3): 623-633.
|
|---|
RP10874-100 mg
| 100 mg | $ 3200.00 |
|---|
| Full Name | |
| Alias |
Exendin4, exenatide; Byetta |
Sequence
(one-letter code) |
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Sequence
(three-letter code) | {HIS}{GLY}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{LEU}
{SER}{LYS}{GLN}{MET}{GLU}{GLU}{GLU}{ALA}{VAL}{ARG}
{LEU}{PHE}{ILE}{GLU}{TRP}{LEU}{LYS}{ASN}{GLY}{GLY}
{PRO}{SER}{SER}{GLY}{ALA}{PRO}{PRO}{PRO}{SER}-NH2 |
|---|
| C-Terminal | NH2 |
|---|
| Description | Exendin-4 is a 39-amino acid peptide amide. Exendin-4, like Exendin-3, stimulates an increase in acinar cAMP without stimulating the release of amylase. Exendin-4 is a long-acting potent agonist of the glucagon-like peptide 1 (GLP-1). Exendin-4 is the active component of Byetta (exenatide) injection, which may improve glycemic control in people with type 2 diabetes mellitus and has the potential to reduce plasma glucose at least partly by a delay in gastric emptying as well as by reducing calorie intake. Exendin-4 enhances glucose-dependent insulin secretion by the pancreatic β-cell and suppresses inappropriately elevated glucagon secretion. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
|---|
| Formula | C184H282N50O60S |
|---|
| M.W. | 4186.66 |
|---|
| Cas | 141758-74-9 |
|---|
| Purity | > 95% |
|---|
| Storage | Store the peptide at -20°C. |
| Notes | This peptide interacts interacts with exendin receptor to increase pancreatic acinar cAMP. It has no secretagogue activity and does not bind to VIP receptors. |
|---|
