GenScript Catalog Peptide: Calcitonin, chicken (RP11096)

Suzuki N, et al. Nucleotide sequences of reptile calcitonins: their high homology to chicken calcitonin. Zool. Sci. Oct 1997; 14(5): 833-836.
Ishikawa Y, et al. Effects of calcitonin and parathyroid hormone on calcification of primary cultures of chicken growth plate chondrocytes. J. Bone Miner. Res. Mar 1997; 12(3): 356-366.
Malgaroli A, et al. Control of cytosolic free calcium in rat and chicken osteoclasts. The role of extracellular calcium and calcitonin. J. Biol. Chem. Aug 1989; 264(24): 14342-14347.

Full Name

Calcitonin, chicken

Sequence
(one-letter code)

CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH₂

Sequence
(three-letter code)

{CYS}{ALA}{SER}{LEU}{SER}{THR}{CYS}{VAL}{LEU}{GLY}
{LYS}{LEU}{SER}{GLN}{GLU}{LEU}{HIS}{LYS}{LEU}{GLN}
{THR}{TYR}{PRO}{ARG}{THR}{ASP}{VAL}{GLY}{ALA}{GLY}
{THR}{PRO}-NH₂

C-Terminal

NH₂

Chemical Bridge

Disulfide bridge: Cys¹-⁷

Description

Calcitonin is a hormone known to participate in calcium and phosphorus metabolism. Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems. The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.

Solubility

Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Formula

C₁₄₅H₂₄₀N₄₂O₄₆S₂

M.W.

3371.9

Cas

100016-62-4

Purity

> 95%

Storage

Store at -20�C.

Notes

Calcitonin (chicken), which is a single chain peptide with 32 amino acids, stimulates bone formation by inhibiting osteoblasts. Calcitonin induces bone resorption and increases cAMP levels in osteoclasts.

* For Non-Clinical Research Use Only *

Precast Gels

Code	Name	Size	Price
RP11099	peptide : Calcitonin, salmon	0.5 mg	$ 57.00
RP11098	peptide : Calcitonin, rat	0.5 mg	$ 71.00
RP12786	peptide : Calcitonin, eel	1 mg	$ 109.00
RP12786	peptide : Calcitonin, eel	5 mg	$ 451.00
RP11095	peptide : Calcitonin Gene Related Peptide (CGRP), rat	0.5 mg	$ 128.00
RP11093	peptide : Calcitonin Gene Related Peptide (CGRP), chicken	0.5 mg	$ 119.00
RP11092	peptide : Calcitonin Gene Related Peptide (CGRP) II, rat	0.5 mg	$ 119.00
RP11090	peptide : Calcitonin Gene Related Peptide (CGRP) (8-37), rat	0.5 mg	$ 90.00
RP11089	peptide : Calcitonin Gene Related Peptide (CGRP) (8-37), human	0.5 mg	$ 90.00
RP13606	peptide : Calcitonin (8-32), salmon	0.2 mg	$ 138.00


1	Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2	Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptide^TM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3	Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (²H, ¹⁵N, and ¹³C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4	Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.