Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Calcitonin, chicken   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Calcitonin, chicken

Cat. No. Size Price Figures
RP11096-0.5 mg
 		0.5 mg
$ 71.25
HPLC:  20060721145620  (PDF)
MS:  20060721145600  (PDF)
MSDS:  20080814023327  (PDF)


References:
  • Suzuki N, et al. Nucleotide sequences of reptile calcitonins: their high homology to chicken calcitonin. Zool. Sci. Oct 1997; 14(5): 833-836.
  • Ishikawa Y, et al. Effects of calcitonin and parathyroid hormone on calcification of primary cultures of chicken growth plate chondrocytes. J. Bone Miner. Res. Mar 1997; 12(3): 356-366.
  • Malgaroli A, et al. Control of cytosolic free calcium in rat and chicken osteoclasts. The role of extracellular calcium and calcitonin. J. Biol. Chem. Aug 1989; 264(24): 14342-14347.
Full Name
Calcitonin, chicken
Sequence
(one-letter code)		 CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2
Sequence
(three-letter code)		{CYS}{ALA}{SER}{LEU}{SER}{THR}{CYS}{VAL}{LEU}{GLY}
{LYS}{LEU}{SER}{GLN}{GLU}{LEU}{HIS}{LYS}{LEU}{GLN}
{THR}{TYR}{PRO}{ARG}{THR}{ASP}{VAL}{GLY}{ALA}{GLY}
{THR}{PRO}-NH2
C-TerminalNH2
Chemical BridgeDisulfide bridge: Cys1-7
DescriptionCalcitonin is a hormone known to participate in calcium and phosphorus metabolism. Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems. The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC145H240N42O46S2
M.W.3371.9
Cas100016-62-4
Purity> 95%
StorageStore at -20°C.
NotesCalcitonin (chicken), which is a single chain peptide with 32 amino acids, stimulates bone formation by inhibiting osteoblasts. Calcitonin induces bone resorption and increases cAMP levels in osteoclasts.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11099peptide : Calcitonin, salmon0.5 mg
$ 57.00
RP11098 peptide : Calcitonin, rat0.5 mg
$ 71.25
RP12786peptide : Calcitonin, eel1 mg
$ 109.25
5 mg
$ 451.25
RP11095 peptide : Calcitonin Gene Related Peptide (CGRP), rat0.5 mg
$ 128.25
RP11093peptide : Calcitonin Gene Related Peptide (CGRP), chicken0.5 mg
$ 118.75
RP11092 peptide : Calcitonin Gene Related Peptide (CGRP) II, rat0.5 mg
$ 118.75
RP11090peptide : Calcitonin Gene Related Peptide (CGRP) (8-37), rat0.5 mg
$ 90.25
RP11089 peptide : Calcitonin Gene Related Peptide (CGRP) (8-37), human0.5 mg
$ 90.25
RP13606peptide : Calcitonin (8-32), salmon0.2 mg
$ 137.75




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.